Recombinant Human Kv1.4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Kv1.4 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 562 - 652 of Human KCNA4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
KCNA4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Kv1.4 Protein

  • cardiac potassium channel
  • fetal skeletal muscle potassium channel
  • HBK4
  • HK1
  • HPCN2HUKII
  • KCNA4L
  • KCNA8
  • KV1.4
  • PCN2
  • potassium channel 2
  • potassium voltage-gated channel subfamily A member 4
  • potassium voltage-gated channel, shaker-related subfamily, member 4
  • potassium voltage-gated channel, shaker-related subfamily, member 4-like
  • rapidly inactivating potassium channel
  • shaker-related potassium channel Kv1.4
  • type A potassium channel
  • Voltage-gated K(+) channel HuKII
  • Voltage-gated potassium channel HBK4
  • Voltage-gated potassium channel HK1
  • Voltage-gated potassium channel subunit Kv1.4

Background

KCNA4 - potassium voltage-gated channel, shaker-related subfamily, member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NBP2-52497
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP2-19315
Species: Hu
Applications: WB
NBP1-42802
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
H00003736-B01P
Species: Hu
Applications: WB
NBP2-38498
Species: Hu
Applications: IHC, IHC-P
NBL1-12154
Species: Hu
H00003738-M01
Species: Hu
Applications: WB, ELISA
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89717
Species: Hu
Applications: IHC, IHC-P
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP1-47609
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-02272
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB2337
Species: Hu
Applications: WB, IP
MAB4104
Species: Hu
Applications: WB, IP, Neut
NB500-180
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP
NBP2-14986
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00030819-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, RNAi
NBP1-81336
Species: Hu
Applications: WB, IHC, IHC-P
H00003739-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Kv1.4 Partial Recombinant Protein (H00003739-Q01) (0)

There are no publications for Kv1.4 Partial Recombinant Protein (H00003739-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv1.4 Partial Recombinant Protein (H00003739-Q01) (0)

There are no reviews for Kv1.4 Partial Recombinant Protein (H00003739-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv1.4 Partial Recombinant Protein (H00003739-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kv1.4 Products

Bioinformatics Tool for Kv1.4 Partial Recombinant Protein (H00003739-Q01)

Discover related pathways, diseases and genes to Kv1.4 Partial Recombinant Protein (H00003739-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv1.4 Partial Recombinant Protein (H00003739-Q01)

Discover more about diseases related to Kv1.4 Partial Recombinant Protein (H00003739-Q01).
 

Pathways for Kv1.4 Partial Recombinant Protein (H00003739-Q01)

View related products by pathway.

PTMs for Kv1.4 Partial Recombinant Protein (H00003739-Q01)

Learn more about PTMs related to Kv1.4 Partial Recombinant Protein (H00003739-Q01).

Blogs on Kv1.4

There are no specific blogs for Kv1.4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Kif2a Antibody
NB500-180
Kv1.4 Antibody
NBP1-89691

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Kv1.4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNA4