Recombinant Human Kv1.4 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Kv1.4 Protein [H00003739-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human Kv1.4 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 562-652 of Human Kv1.4

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETD

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
KCNA4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
35.75 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Kv1.4 GST (N-Term) Protein

  • cardiac potassium channel
  • fetal skeletal muscle potassium channel
  • HBK4
  • HK1
  • HPCN2
  • HPCN2HUKII
  • KCNA4
  • KCNA4L
  • KCNA8
  • Kv1.4
  • PCN2
  • potassium channel 2
  • potassium voltage-gated channel subfamily A member 4
  • potassium voltage-gated channel, shaker-related subfamily, member 4
  • potassium voltage-gated channel, shaker-related subfamily, member 4-like
  • rapidly inactivating potassium channel
  • shaker-related potassium channel Kv1.4
  • type A potassium channel
  • Voltage-gated K(+) channel HuKII
  • Voltage-gated potassium channel HBK4
  • Voltage-gated potassium channel HK1
  • Voltage-gated potassium channel subunit Kv1.4

Background

KCNA4 - potassium voltage-gated channel, shaker-related subfamily, member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NBP3-03748
Species: Mu
Applications: IHC, IHC-P, WB
NBP3-03750
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-10293
Species: Hu
Applications: WB
NBP3-03729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-38498
Species: Hu
Applications: IHC, IHC-P
NBP3-03109
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-48533
Species: Hu
Applications: IHC, IHC-P
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP3-24946
Species: Hu
Applications: ICC/IF
H00003753-M01
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP2-85189
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-16814
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB2337
Species: Hu
Applications: IP, WB
NBP1-06046
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NB500-180
Species: Hu, Ma, Mu, Po, Rt
Applications: ICC/IF, IP, KO, Simple Western, WB
DKK300
Species: Hu
Applications: ELISA
NBP2-14986
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00030819-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, WB
NBP1-81336
Species: Hu, In
Applications: IHC, IHC-P, WB

Publications for Kv1.4 Partial Recombinant Protein (H00003739-Q01) (0)

There are no publications for Kv1.4 Partial Recombinant Protein (H00003739-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv1.4 Partial Recombinant Protein (H00003739-Q01) (0)

There are no reviews for Kv1.4 Partial Recombinant Protein (H00003739-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv1.4 Partial Recombinant Protein (H00003739-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kv1.4 Products

Array H00003739-Q01

Diseases for Kv1.4 Partial Recombinant Protein (H00003739-Q01)

Discover more about diseases related to Kv1.4 Partial Recombinant Protein (H00003739-Q01).
 

Pathways for Kv1.4 Partial Recombinant Protein (H00003739-Q01)

View related products by pathway.

PTMs for Kv1.4 Partial Recombinant Protein (H00003739-Q01)

Learn more about PTMs related to Kv1.4 Partial Recombinant Protein (H00003739-Q01).
 

Research Areas for Kv1.4 Partial Recombinant Protein (H00003739-Q01)

Find related products by research area.

Blogs on Kv1.4

There are no specific blogs for Kv1.4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Kv1.4 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNA4