Kv1.1 Recombinant Protein Antigen

Images

 
There are currently no images for Kv1.1 Recombinant Protein Antigen (NBP3-17729PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Kv1.1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Kv1.1

Source: E. coli

Amino Acid Sequence: QLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17729.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kv1.1 Recombinant Protein Antigen

  • AEMK
  • EA1
  • HBK1
  • HUK1
  • KCNA1
  • Kv1.1
  • MBK1
  • MGC126782
  • MGC138385
  • MK1
  • potassium voltage-gated channel subfamily A member 1
  • potassium voltage-gated channel, shaker-related subfamily, member 1 (episodicataxia with myokymia)
  • RBK1
  • Voltage-gated K(+) channel HuKI
  • Voltage-gated potassium channel HBK1
  • Voltage-gated potassium channel subunit Kv1.1

Background

Kv1.1 belongs to a (Shaker) subfamily of the pota ium channel family. It is a major constituent of presynaptic A-type channels that modulate synaptic transmi ion in CNS neurons. Kv1.1-containing channels have been shown to be complexed with Lgi1, which is causative for an autosomal dominant form of lateral temporal lobe epilepsy. In the hippocampus Kv1.1 and Lgi1 are coa embled with Kv1.4 and Kv 1 in axonal terminals. Kv1.1 is an abundant Kv subunit in the brain that is found predominantly localized to axons and nerve terminals. Mutations in human Kv1.1 result in the dominant disorder Episodic Ataxia Type 1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-46349
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP2-48533
Species: Hu
Applications: IHC,  IHC-P
NBP3-46347
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP2-76939
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-24946
Species: Hu
Applications: ICC/IF
NBP2-38498
Species: Hu
Applications: IHC,  IHC-P
NBP3-03750
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP3-30941
Species: Hu, Rt
Applications: IHC, WB
NB300-279
Species: Ha, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP3-03748
Species: Mu
Applications: IHC,  IHC-P, WB
AF7548
Species: Hu
Applications: IHC
NBP2-85189
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-20119
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-12900
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, MiAr, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-38323
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88182
Species: Hu
Applications: IHC,  IHC-P, WB
H00009261-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, PLA, Simple Western, WB

Publications for Kv1.1 Recombinant Protein Antigen (NBP3-17729PEP) (0)

There are no publications for Kv1.1 Recombinant Protein Antigen (NBP3-17729PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv1.1 Recombinant Protein Antigen (NBP3-17729PEP) (0)

There are no reviews for Kv1.1 Recombinant Protein Antigen (NBP3-17729PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kv1.1 Recombinant Protein Antigen (NBP3-17729PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kv1.1 Products

Research Areas for Kv1.1 Recombinant Protein Antigen (NBP3-17729PEP)

Find related products by research area.

Blogs on Kv1.1

There are no specific blogs for Kv1.1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kv1.1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNA1