Kv1.1 Antibody (2D8) - Azide and BSA Free

Sandwich ELISA: Kv1.1 Antibody (2D8) [H00003736-M05] - Detection limit for recombinant GST tagged KCNA1 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2D8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Kv1.1 Antibody (2D8) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: KCNA1 (NP_000208.1, 410 a.a. ~ 495 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NFNYFYHRETEGEEQAQLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTDV
• Specificity: Reacts with potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia).
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: KCNA1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Kv1.1 Antibody (2D8) - Azide and BSA Free

• AEMK
• EA1
• HBK1
• HUK1
• KCNA1
• Kv1.1
• MBK1
• MGC126782
• MGC138385
• MK1
• potassium voltage-gated channel subfamily A member 1
• potassium voltage-gated channel, shaker-related subfamily, member 1 (episodicataxia with myokymia)
• RBK1
• Voltage-gated K(+) channel HuKI
• Voltage-gated potassium channel HBK1
• Voltage-gated potassium channel subunit Kv1.1

Background

This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments (S1-S6), and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif (GYGD). The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia (AEMK). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNA1
• Entrez:
  • 3736(Human)
• Uniprot:
  • NP_000208(Human)