Recombinant Human KPNA5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human KPNA5 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 539 of Human KPNA5 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDAMASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDESMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPIDQVIQKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLNSEHEDVQEQAVWALGNIAGDNAECRDFVLNCEILPPLLELLTNSNRLTTTRNAVWALSNLCRGKNPPPNFSKVSPCLNVLSRLLFSSDPDVLADVCWALSYLSDGPNDKIQAVIDSGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVALGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGVEEDDPSIVPQVDENQQQFIFQQQEAPMDGFQL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
KPNA5

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 100 mM NaCl, pH 8.0, 5 mM DTT, 4 mM reduced glutathione, 20% glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KPNA5 Protein

  • importin alpha 6
  • importin subunit alpha-6
  • IPOA6
  • karyopherin alpha 5 (importin alpha 6)
  • Karyopherin subunit alpha-5
  • SRP6

Background

KPNA5( AAH47409, 1 a.a. - 540 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
NBP1-28727
Species: Hu
Applications: IP (-), WB, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP2-57809
Species: Hu
Applications: ICC/IF
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24769
Species: Hu, Mu, Rt, Po, Ca, Eq, Pm
Applications: WB
NB100-56509
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-77242
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-46574
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF3166
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-80871
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57233
Species: Hu
Applications: WB, ICC/IF
NBP2-33939
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80880
Species: Hu
Applications: IHC, IHC-P
H00003841-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for KPNA5 Recombinant Protein (H00003841-P01) (0)

There are no publications for KPNA5 Recombinant Protein (H00003841-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KPNA5 Recombinant Protein (H00003841-P01) (0)

There are no reviews for KPNA5 Recombinant Protein (H00003841-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KPNA5 Recombinant Protein (H00003841-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KPNA5 Products

Bioinformatics Tool for KPNA5 Recombinant Protein (H00003841-P01)

Discover related pathways, diseases and genes to KPNA5 Recombinant Protein (H00003841-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KPNA5 Recombinant Protein (H00003841-P01)

Discover more about diseases related to KPNA5 Recombinant Protein (H00003841-P01).

Blogs on KPNA5

There are no specific blogs for KPNA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

KPNA5 Antibody (1D2)
H00003841-M01
GLI-1 Antibody
NB600-600

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KPNA5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KPNA5