We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

KPNA5 Recombinant Protein Antigen

Images

 
There are currently no images for KPNA5 Protein (NBP2-38715PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KPNA5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KPNA5.

Source: E. coli

Amino Acid Sequence: KRRNVYLPRNDESMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KPNA5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38715.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KPNA5 Recombinant Protein Antigen

  • importin alpha 6
  • importin subunit alpha-6
  • IPOA6
  • karyopherin alpha 5 (importin alpha 6)
  • Karyopherin subunit alpha-5
  • SRP6

Background

The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA5 protein belongs to the importin alpha protein family and is thought to be involved in NLS-dependent protein import into the nucleus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19807
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45626
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-28727
Species: Hu, Mu
Applications: Flow, IHC,  IHC-P, IP, WB
NBP3-35070
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-18041
Species: Hu
Applications: ELISA, S-ELISA
NBP3-46122
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-87109
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP3-04382
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56509
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IB, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-88223
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-46574
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF3166
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-80871
Species: Hu
Applications: IHC,  IHC-P
NBP3-35826
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB300-889
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA
NBP3-16867
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-80880
Species: Hu
Applications: IHC,  IHC-P

Publications for KPNA5 Protein (NBP2-38715PEP) (0)

There are no publications for KPNA5 Protein (NBP2-38715PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KPNA5 Protein (NBP2-38715PEP) (0)

There are no reviews for KPNA5 Protein (NBP2-38715PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KPNA5 Protein (NBP2-38715PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KPNA5 Products

Blogs on KPNA5

There are no specific blogs for KPNA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KPNA5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KPNA5