KLHL15 Antibody


Western Blot: KLHL15 Antibody [NBP1-70593] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB
Please see the vial label for concentration. If unlisted please contact technical services.

Order Details

KLHL15 Antibody Summary

Synthetic peptides corresponding to KLHL15(kelch-like 15 (Drosophila)) The peptide sequence was selected from the middle region of KLHL15. Peptide sequence VLDKQIMVLGGLCYNGHYSDSILTFDPDENKWKEDEYPRMPCKLDGLQVC.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against KLHL15 and was validated on Western blot.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KLHL15 Antibody

  • kelch-like 15 (Drosophila)
  • kelch-like protein 15
  • KIAA1677
  • MGC126148
  • MGC126149


KLHL15 is a member of the kelch-like family of proteins that share a common domain structure consisting of an N-terminal broad-complex, tramtrack, bric-a-brac/poxvirus and zinc finger domain and C-terminal kelch repeat motifs. KLHL15 may be involved in protein ubiquitination and cytoskeletal organization.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for KLHL15 Antibody (NBP1-70593) (0)

There are no publications for KLHL15 Antibody (NBP1-70593).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLHL15 Antibody (NBP1-70593) (0)

There are no reviews for KLHL15 Antibody (NBP1-70593). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLHL15 Antibody (NBP1-70593) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KLHL15 Antibody Products

Related Products by Gene

Bioinformatics Tool for KLHL15 Antibody (NBP1-70593)

Discover related pathways, diseases and genes to KLHL15 Antibody (NBP1-70593). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLHL15 Antibody (NBP1-70593)

Discover more about diseases related to KLHL15 Antibody (NBP1-70593).

Pathways for KLHL15 Antibody (NBP1-70593)

View related products by pathway.

PTMs for KLHL15 Antibody (NBP1-70593)

Learn more about PTMs related to KLHL15 Antibody (NBP1-70593).

Blogs on KLHL15

There are no specific blogs for KLHL15, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol KLHL15

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-70593 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought