KLHL15 Antibody

Images

 
Western Blot: KLHL15 Antibody [NBP1-70593] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KLHL15 Antibody Summary

Immunogen
Synthetic peptides corresponding to KLHL15(kelch-like 15 (Drosophila)) The peptide sequence was selected from the middle region of KLHL15. Peptide sequence VLDKQIMVLGGLCYNGHYSDSILTFDPDENKWKEDEYPRMPCKLDGLQVC.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLHL15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against KLHL15 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KLHL15 Antibody

  • kelch-like 15 (Drosophila)
  • kelch-like protein 15
  • KIAA1677
  • MGC126148
  • MGC126149

Background

KLHL15 is a member of the kelch-like family of proteins that share a common domain structure consisting of an N-terminal broad-complex, tramtrack, bric-a-brac/poxvirus and zinc finger domain and C-terminal kelch repeat motifs. KLHL15 may be involved in protein ubiquitination and cytoskeletal organization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02939
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NB100-58788
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P

Publications for KLHL15 Antibody (NBP1-70593) (0)

There are no publications for KLHL15 Antibody (NBP1-70593).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLHL15 Antibody (NBP1-70593) (0)

There are no reviews for KLHL15 Antibody (NBP1-70593). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLHL15 Antibody (NBP1-70593) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KLHL15 Products

Bioinformatics Tool for KLHL15 Antibody (NBP1-70593)

Discover related pathways, diseases and genes to KLHL15 Antibody (NBP1-70593). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLHL15 Antibody (NBP1-70593)

Discover more about diseases related to KLHL15 Antibody (NBP1-70593).
 

Pathways for KLHL15 Antibody (NBP1-70593)

View related products by pathway.

PTMs for KLHL15 Antibody (NBP1-70593)

Learn more about PTMs related to KLHL15 Antibody (NBP1-70593).

Blogs on KLHL15

There are no specific blogs for KLHL15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLHL15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLHL15