![Immunocytochemistry/Immunofluorescence: KIF18B Antibody [NBP1-90882] - Staining of human cell line U-251 MG shows localization to nucleus, cytosol and microtubule ends. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/KIF18B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90882-img0010.jpg "Immunocytochemistry/Immunofluorescence: KIF18B Antibody [NBP1-90882] - Staining of human cell line U-251 MG shows localization to nucleus, cytosol and microtubule ends. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit KIF18B Antibody - BSA Free (NBP1-90882) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-KIF18B Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: STLQVVVRVRPPTPRELDSQRRPVVQVVDERVLVFNPEEPDGGFPGLKWGGTHDGPKKKGKDLTFVFDRVFGEAATQQDVFQHTTHSVLDSFLQGYN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KIF18B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-90882 | Applications | Species |
|---|---|---|
| Yin X, Wang Z, Wang J et al. Development of a novel gene signature to predict prognosis and response to PD-1 blockade in clear cell renal cell carcinoma OncoImmunology 2021-07-15 [PMID: 34262797] (Immunohistochemistry) | Immunohistochemistry |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KIF18B |
![Immunohistochemistry-Paraffin: KIF18B Antibody [NBP1-90882] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/KIF18B-Antibody-Immunohistochemistry-Paraffin-NBP1-90882-img0014.jpg "Immunohistochemistry-Paraffin: KIF18B Antibody [NBP1-90882] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: KIF18B Antibody [NBP1-90882] - Staining of human lymph node shows strong nuclear positivity in germinal center cells.](http://images.novusbio.com/fullsize/KIF18B-Antibody-Immunohistochemistry-Paraffin-NBP1-90882-img0012.jpg "Immunohistochemistry-Paraffin: KIF18B Antibody [NBP1-90882] - Staining of human lymph node shows strong nuclear positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: KIF18B Antibody [NBP1-90882] - Staining of human duodenum shows strong nuclear positivity in a subset of lymphoid cells.](http://images.novusbio.com/fullsize/KIF18B-Antibody-Immunohistochemistry-Paraffin-NBP1-90882-img0013.jpg "Immunohistochemistry-Paraffin: KIF18B Antibody [NBP1-90882] - Staining of human duodenum shows strong nuclear positivity in a subset of lymphoid cells.")
![Immunohistochemistry-Paraffin: KIF18B Antibody [NBP1-90882] - Staining of human prostate shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/KIF18B-Antibody-Immunohistochemistry-Paraffin-NBP1-90882-img0015.jpg "Immunohistochemistry-Paraffin: KIF18B Antibody [NBP1-90882] - Staining of human prostate shows no positivity in glandular cells as expected.")
![Immunohistochemistry Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Immunohistochemistry_11792.jpg)
![Western Blot Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Western_Blot_9526.jpg)
![Simple Western Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Simple_Western_20094.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")