KANK3 Antibody - BSA Free

Western Blot: KANK3 Antibody [NBP2-14138] - Analysis in control (vector only transfected HEK293T lysate) and KANK3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: KANK3 Antibody [NBP2-14138] - Staining of human cell line U-2 OS shows localization to plasma membrane.

Immunohistochemistry-Paraffin: KANK3 Antibody [NBP2-14138] - Stainng of human liver shows no positivity in hepatocytes.

Immunohistochemistry-Paraffin: KANK3 Antibody [NBP2-14138] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: KANK3 Antibody [NBP2-14138] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: KANK3 Antibody [NBP2-14138] - Staining of human kidney shows strong membranous and ctyoplasmic positivity in cells in glomeruli.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KANK3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KANK3 Antibody - BSA Free (NBP2-14138) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: QLREATTQTPWSCAEKAAQTESPAEAPSLTQESSPGSMDGDRAVAPAGILKSIMK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KANK3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  KANK3 Protein (NBP2-14138PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KANK3 Antibody - BSA Free

• ANKRD47
• ankyrin repeat domain 47
• Ankyrin repeat domain-containing protein 47
• FLJ46061
• kidney ankyrin repeat-containing protein 3
• KN motif and ankyrin repeat domain-containing protein 3
• KN motif and ankyrin repeat domains 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KANK3