KANK3 Antibody


Western Blot: KANK3 Antibody [NBP2-14138] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: KANK3 Antibody [NBP2-14138] - Staining of human cell line U-2 OS shows localization to plasma membrane.
Immunohistochemistry-Paraffin: KANK3 Antibody [NBP2-14138] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules while cells in glomeruli exhibited strong membranous staining.
Immunohistochemistry-Paraffin: KANK3 Antibody [NBP2-14138] - Staining of human spleen shows strong positivity in lymphatic tissue.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

KANK3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QLREATTQTPWSCAEKAAQTESPAEAPSLTQESSPGSMDGDRAVAPAGIL KSIMK
Specificity of human KANK3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KANK3 Protein (NBP2-14138PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for KANK3 Antibody

  • ANKRD47
  • ankyrin repeat domain 47
  • Ankyrin repeat domain-containing protein 47
  • FLJ46061
  • kidney ankyrin repeat-containing protein 3
  • KN motif and ankyrin repeat domain-containing protein 3
  • KN motif and ankyrin repeat domains 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: IHC, IHC-P
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KANK3 Antibody (NBP2-14138) (0)

There are no publications for KANK3 Antibody (NBP2-14138).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KANK3 Antibody (NBP2-14138) (0)

There are no reviews for KANK3 Antibody (NBP2-14138). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KANK3 Antibody (NBP2-14138) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KANK3 Products

Bioinformatics Tool for KANK3 Antibody (NBP2-14138)

Discover related pathways, diseases and genes to KANK3 Antibody (NBP2-14138). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KANK3 Antibody (NBP2-14138)

Discover more about diseases related to KANK3 Antibody (NBP2-14138).

Pathways for KANK3 Antibody (NBP2-14138)

View related products by pathway.

Blogs on KANK3

There are no specific blogs for KANK3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KANK3 Antibody and receive a gift card or discount.


Gene Symbol KANK3