Kallikrein 13 Recombinant Protein Antigen

Product Discontinued

Kallikrein 13 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Kallikrein 13.
  
  

  Source: E. coli

  Amino Acid Sequence: LKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLNHDHDIMLLELQSPVQLTGYIQTLPLSHNNRLTPGTT

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: KLK13
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49358.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kallikrein 13 Recombinant Protein Antigen

• DKFZp586J1923
• EC 3.4.21
• EC 3.4.21.-
• Kallikrein 13
• Kallikrein-like protein 4
• kallikrein-related peptidase 13
• KLK13
• KLK-L4kallikrein-13
• KLKL4kallikrein-like gene 4

Background

KLK13, also known as Kallikrein 13, is a 30,6 kDa 277 amino acid protein, expressed in prostate, breast, testis and salivary gland, belongs to the peptidase S1 family, kallikrein subfamily. Kallikreins are a subgroup of serine proteases having diverse physiological functions including their implication in carcinogenesis based on growing evidence. Disease research is currently being studied with relation to KLK13 and ovarian cancer, breast cancer, noma, testicular cancer, lung adenocarcinoma, prostatitis, prostate cancer, and carcinoma. Interactions with KLK13 protein have been shown to involve SERPINF2, SERPINA1, and A2M in proteolysis and protein processing pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: KLK13