INO80C Antibody


Western Blot: INO80C Antibody [NBP2-14123] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: HELA
Immunocytochemistry/ Immunofluorescence: INO80C Antibody [NBP2-14123] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center.
Immunohistochemistry-Paraffin: INO80C Antibody [NBP2-14123] - Staining of human testis shows nuclear positivity in cells in seminiferous ducts.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

INO80C Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GYGASKKKKASASSFAQGISMEAMSENKMVPSEFSTGPVEKAAKPLPFKD PNFVHSGHGGAVAGKKNRT
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
INO80C Protein (NBP2-14123PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for INO80C Antibody

  • C18orf37
  • chromosome 18 open reading frame 37
  • FLJ38183
  • hIes6
  • IES6 homolog
  • IES6
  • INO80 complex subunit C


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
Species: Hu
Applications: WB, IP, PLA
Species: Hu
Species: Hu
Applications: WB (-), IP
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for INO80C Antibody (NBP2-14123) (0)

There are no publications for INO80C Antibody (NBP2-14123).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INO80C Antibody (NBP2-14123) (0)

There are no reviews for INO80C Antibody (NBP2-14123). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for INO80C Antibody (NBP2-14123) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional INO80C Products

INO80C NBP2-14123

Bioinformatics Tool for INO80C Antibody (NBP2-14123)

Discover related pathways, diseases and genes to INO80C Antibody (NBP2-14123). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on INO80C

There are no specific blogs for INO80C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our INO80C Antibody and receive a gift card or discount.


Gene Symbol INO80C