INO80C Antibody - BSA Free

Immunohistochemistry-Paraffin: INO80C Antibody [NBP2-14123] - Staining in human testis and skeletal muscle tissues.. Corresponding INO80C RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: INO80C Antibody [NBP2-14123] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center.

Immunohistochemistry-Paraffin: INO80C Antibody [NBP2-14123] - Staining of human kidney shows weak to moderate positivity in cells in tubules.

Immunohistochemistry-Paraffin: INO80C Antibody [NBP2-14123] - Staining of human testis shows weak nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: INO80C Antibody [NBP2-14123] - Staining of human skeletal muscle shows very weak positivity in myocytes.

ChIP-Exo-Seq composite graph for Anti-INO80C (NBP2-14123) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

INO80C Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GYGASKKKKASASSFAQGISMEAMSENKMVPSEFSTGPVEKAAKPLPFKDPNFVHSGHGGAVAGKKNRT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: INO80C
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
• Application Notes: IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  INO80C Protein (NBP2-14123PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for INO80C Antibody - BSA Free

• C18orf37
• chromosome 18 open reading frame 37
• FLJ38183
• hIes6
• IES6 homolog
• IES6
• INO80 complex subunit C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: INO80C