Recombinant Human HOXD8 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human HOXD8 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 126-190 of Human HOXD8

Source: Wheat Germ

Amino Acid Sequence: GIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
HOXD8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
32.89 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HOXD8 Protein

  • homeo box 4E
  • homeo box D8
  • homeobox D8
  • homeobox protein 5.4
  • Homeobox protein Hox-4E
  • Homeobox protein Hox-5.4
  • homeobox protein Hox-D8
  • HOX4
  • HOX4EHox-4.5
  • HOX5.4

Background

HOXD8 - homeo box D8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55738
Species: Hu
Applications: ICC/IF
NBP1-52085
Species: Hu, Mu
Applications: WB, PEP-ELISA
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBP2-54948
Species: Hu
Applications: ICC/IF
NBP2-45744
Species: Hu
Applications: WB, IHC
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-11664
Species: Hu
NBP2-14098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56537
Species: Hu
Applications: ICC/IF
NBP2-56195
Species: Hu
Applications: WB, ICC/IF
NBP1-81718
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56557
Species: Hu
Applications: ICC/IF
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32356
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003209-Q01
Species: Hu
NBP2-32515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83234
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52149
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
AF5014
Species: Hu
Applications: WB, ICC
H00003228-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for HOXD8 Partial Recombinant Protein (H00003234-Q01) (0)

There are no publications for HOXD8 Partial Recombinant Protein (H00003234-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXD8 Partial Recombinant Protein (H00003234-Q01) (0)

There are no reviews for HOXD8 Partial Recombinant Protein (H00003234-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXD8 Partial Recombinant Protein (H00003234-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HOXD8 Products

Bioinformatics Tool for HOXD8 Partial Recombinant Protein (H00003234-Q01)

Discover related pathways, diseases and genes to HOXD8 Partial Recombinant Protein (H00003234-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXD8 Partial Recombinant Protein (H00003234-Q01)

Discover more about diseases related to HOXD8 Partial Recombinant Protein (H00003234-Q01).
 

Pathways for HOXD8 Partial Recombinant Protein (H00003234-Q01)

View related products by pathway.

PTMs for HOXD8 Partial Recombinant Protein (H00003234-Q01)

Learn more about PTMs related to HOXD8 Partial Recombinant Protein (H00003234-Q01).

Blogs on HOXD8

There are no specific blogs for HOXD8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HOXA9 Antibody
NBP2-32356
HOXD8 Antibody
NBP2-27108

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HOXD8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXD8