HOXD8 Antibody (10F8)

Product Discontinued

HOXD8 Antibody (10F8) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: HOXD8 (NP_062458 126 a.a. - 190 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMR
• Specificity: HOXD8 - homeo box D8
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HOXD8
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • RNA Inhibition
  • Western Blot
• Application Notes: Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXD8 Antibody (10F8)

• homeo box 4E
• homeo box D8
• homeobox D8
• homeobox protein 5.4
• Homeobox protein Hox-4E
• Homeobox protein Hox-5.4
• homeobox protein Hox-D8
• HOX4
• HOX4EHox-4.5
• HOX5.4

Background

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. In addition to effects during embryogenesis, this particular gene may also play a role in adult urogenital tract function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HOXD8
• Entrez:
  • 3234(Human)
• OMIM:
  • 142985(Human)
• Uniprot:
  • NP_062458(Human)