HOXD4 Recombinant Protein Antigen

Images

 
There are currently no images for HOXD4 Recombinant Protein Antigen (NBP2-49631PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HOXD4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HOXD4.

Source: E. coli

Amino Acid Sequence: ARAYSQSDPKQPPSGTALKQPAVVYPWMKKV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HOXD4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49631.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HOXD4 Recombinant Protein Antigen

  • HHO.C13
  • homeo box D4
  • homeobox D4
  • Homeobox protein HHO.C13
  • Homeobox protein Hox-4B
  • Homeobox protein Hox-5.1
  • homeobox protein Hox-D4
  • HOX4
  • Hox-4.2
  • Hox-4.2, mouse, homolog of homeo box X
  • HOX4BHOX-5.1

Background

HOXD4 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5' end of this cluster have been associated with severe limb and genital abnormalities. The protein encoded by this gene may play a role in determining positional values in developing limb buds. Alternatively spliced variants have been described but their full length nature has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45744
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-55738
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF
NBP2-24561
Species: Bv, Fe, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
H00003223-M04
Species: Hu
Applications: ELISA, WB
NBP1-52085
Species: Hu, Mu
Applications: PEP-ELISA, WB
NBP2-32515
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-56195
Species: Hu
Applications: ICC/IF, WB
NBP1-81718
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
NBP3-47382
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
H00003232-M09
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
H00003237-M10
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-87596
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-85008
Species: Hu, Mu
Applications: WB
H00003204-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
H00003231-M01
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP1-80228
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-11884
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, RIA, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-83235
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-49631PEP
Species: Hu
Applications: AC

Publications for HOXD4 Recombinant Protein Antigen (NBP2-49631PEP) (0)

There are no publications for HOXD4 Recombinant Protein Antigen (NBP2-49631PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXD4 Recombinant Protein Antigen (NBP2-49631PEP) (0)

There are no reviews for HOXD4 Recombinant Protein Antigen (NBP2-49631PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HOXD4 Recombinant Protein Antigen (NBP2-49631PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HOXD4 Products

Blogs on HOXD4

There are no specific blogs for HOXD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HOXD4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXD4