Recombinant Human HOXD4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HOXD4 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 62 of Human HOXD4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
HOXD4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HOXD4 Protein

  • HHO.C13
  • homeo box D4
  • homeobox D4
  • Homeobox protein HHO.C13
  • Homeobox protein Hox-4B
  • Homeobox protein Hox-5.1
  • homeobox protein Hox-D4
  • HOX4
  • Hox-4.2
  • Hox-4.2, mouse, homolog of homeo box X
  • HOX4BHOX-5.1

Background

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5' end of this cluster have been associated with severe limb and genital abnormalities. The protein encoded by this gene may play a role in determining positional values in developing limb buds. Alternatively spliced variants have been described but their full length nature has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45744
Species: Hu
Applications: WB, IHC
NBP2-55738
Species: Hu
Applications: ICC/IF
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
H00003223-M04
Species: Hu
Applications: WB, ELISA
NBP1-52085
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP2-32515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56195
Species: Hu
Applications: WB, ICC/IF
NBP1-81718
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-11664
Species: Hu
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-56557
Species: Hu
Applications: ICC/IF
NBP1-83234
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBP2-58710
Species: Hu
Applications: WB, ICC/IF
NBP1-80228
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
H00003233-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for HOXD4 Partial Recombinant Protein (H00003233-Q01) (0)

There are no publications for HOXD4 Partial Recombinant Protein (H00003233-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXD4 Partial Recombinant Protein (H00003233-Q01) (0)

There are no reviews for HOXD4 Partial Recombinant Protein (H00003233-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXD4 Partial Recombinant Protein (H00003233-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HOXD4 Products

Bioinformatics Tool for HOXD4 Partial Recombinant Protein (H00003233-Q01)

Discover related pathways, diseases and genes to HOXD4 Partial Recombinant Protein (H00003233-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXD4 Partial Recombinant Protein (H00003233-Q01)

Discover more about diseases related to HOXD4 Partial Recombinant Protein (H00003233-Q01).
 

Pathways for HOXD4 Partial Recombinant Protein (H00003233-Q01)

View related products by pathway.

PTMs for HOXD4 Partial Recombinant Protein (H00003233-Q01)

Learn more about PTMs related to HOXD4 Partial Recombinant Protein (H00003233-Q01).

Blogs on HOXD4

There are no specific blogs for HOXD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
HOXD4 Antibody
NBP2-49631
HOXB4 Antibody
NBP2-24561

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HOXD4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXD4