Recombinant Human HOXC8 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HOXC8 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 242 of Human HOXC8 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENKD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
HOXC8
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HOXC8 Protein

  • homeo box C8
  • homeobox C8
  • Homeobox protein Hox-3A
  • homeobox protein Hox-C8
  • HOX3
  • Hox-3.1, mouse, homolog of
  • HOX3Ahomeo box 3A

Background

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the regulation of cartilage differentiation. It could also be involved in chondrodysplasias or other cartilage disorders. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003223-M04
Species: Hu
Applications: WB, ELISA
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91973
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
NBP2-45744
Species: Hu
Applications: WB, IHC
NBP2-56537
Species: Hu
Applications: ICC/IF
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55738
Species: Hu
Applications: ICC/IF
NB600-248
Species: Hu
Applications: WB, IP
NBP2-14098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
NBP2-56557
Species: Hu
Applications: ICC/IF
NBL1-11664
Species: Hu
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-81718
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58710
Species: Hu
Applications: WB, ICC/IF
H00003224-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for HOXC8 Recombinant Protein (H00003224-P01) (0)

There are no publications for HOXC8 Recombinant Protein (H00003224-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXC8 Recombinant Protein (H00003224-P01) (0)

There are no reviews for HOXC8 Recombinant Protein (H00003224-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXC8 Recombinant Protein (H00003224-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HOXC8 Products

Bioinformatics Tool for HOXC8 Recombinant Protein (H00003224-P01)

Discover related pathways, diseases and genes to HOXC8 Recombinant Protein (H00003224-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXC8 Recombinant Protein (H00003224-P01)

Discover more about diseases related to HOXC8 Recombinant Protein (H00003224-P01).
 

Pathways for HOXC8 Recombinant Protein (H00003224-P01)

View related products by pathway.

PTMs for HOXC8 Recombinant Protein (H00003224-P01)

Learn more about PTMs related to HOXC8 Recombinant Protein (H00003224-P01).

Blogs on HOXC8

There are no specific blogs for HOXC8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HOXC8 Antibody
NBP1-52085

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HOXC8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXC8