Recombinant Human HOXC10 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human HOXC10 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 158-257 of Human HOXC10

Source: Wheat Germ

Amino Acid Sequence: LDKTPHCSGANDFEAPFEQRASLNPRAEHLESPQLGGKVSFPETPKSDSQTPSPNEIKTEQSLAGPKGSPSESEKERAKAADSSPDTSDNEAKEEIKAEN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
HOXC10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HOXC10 Protein

  • homeo box C10
  • homeobox C10
  • Homeobox protein Hox-3I
  • homeobox protein Hox-C10
  • homeoprotein C10
  • HOX3I
  • MGC5259

Background

HOXC10 - homeo box C10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47428
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32356
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11664
Species: Hu
NBP2-45744
Species: Hu
Applications: WB, IHC
H00003209-Q01
Species: Hu
NBP2-56557
Species: Hu
Applications: ICC/IF
NBP1-88644
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF8156
Species: Hu
Applications: WB, IHC, ICC
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58490
Species: Hu
Applications: ICC/IF
NBP2-43834
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-248
Species: Hu
Applications: WB, IP
AF3025
Species: Hu
Applications: WB, ELISA, ICC
NB300-864
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00003216-M01-100ug
Species: Hu
Applications: WB, ELISA
NBP2-54948
Species: Hu
Applications: ICC/IF
NBP2-00499
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89123
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003226-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for HOXC10 Partial Recombinant Protein (H00003226-Q01) (0)

There are no publications for HOXC10 Partial Recombinant Protein (H00003226-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXC10 Partial Recombinant Protein (H00003226-Q01) (0)

There are no reviews for HOXC10 Partial Recombinant Protein (H00003226-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXC10 Partial Recombinant Protein (H00003226-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HOXC10 Products

Bioinformatics Tool for HOXC10 Partial Recombinant Protein (H00003226-Q01)

Discover related pathways, diseases and genes to HOXC10 Partial Recombinant Protein (H00003226-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXC10 Partial Recombinant Protein (H00003226-Q01)

Discover more about diseases related to HOXC10 Partial Recombinant Protein (H00003226-Q01).
 

Pathways for HOXC10 Partial Recombinant Protein (H00003226-Q01)

View related products by pathway.

PTMs for HOXC10 Partial Recombinant Protein (H00003226-Q01)

Learn more about PTMs related to HOXC10 Partial Recombinant Protein (H00003226-Q01).
 

Research Areas for HOXC10 Partial Recombinant Protein (H00003226-Q01)

Find related products by research area.

Blogs on HOXC10

There are no specific blogs for HOXC10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HOXC10 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXC10