HOXB8 Antibody (4F8)

Images

 
Sandwich ELISA: HOXB8 Antibody (4F8) [H00003218-M01] - Detection limit for recombinant GST tagged HOXB8 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HOXB8 Antibody (4F8) Summary

Immunogen
HOXB8 (NP_076921, 16 a.a. - 114 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAA
Specificity
HOXB8 - homeobox B8 (4F8)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HOXB8
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for WB and Sandwitch ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXB8 Antibody (4F8)

  • homeo box 2D
  • homeo box B8
  • homeobox B8
  • Homeobox protein Hox-2.4
  • Homeobox protein Hox-2D
  • homeobox protein Hox-B8
  • HOX2
  • HOX2DHox-2.4

Background

This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Increased expression of this gene is associated with colorectal cancer. Mice that have had the murine ortholog of this gene knocked out exhibit an excessive pathologic grooming behavior. This behavior is similar to the behavior of humans suffering from the obsessive-compulsive spectrum disorder trichotillomania.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-11673
Species: Hu
NBP1-52085
Species: Hu, Mu
Applications: WB, PEP-ELISA
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
H00003219-D03P
Species: Hu, Mu
Applications: WB
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-32515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83234
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
NBP2-55738
Species: Hu
Applications: ICC/IF
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for HOXB8 Antibody (H00003218-M01) (0)

There are no publications for HOXB8 Antibody (H00003218-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXB8 Antibody (H00003218-M01) (0)

There are no reviews for HOXB8 Antibody (H00003218-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXB8 Antibody (H00003218-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXB8 Products

Bioinformatics Tool for HOXB8 Antibody (H00003218-M01)

Discover related pathways, diseases and genes to HOXB8 Antibody (H00003218-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXB8 Antibody (H00003218-M01)

Discover more about diseases related to HOXB8 Antibody (H00003218-M01).
 

Pathways for HOXB8 Antibody (H00003218-M01)

View related products by pathway.

PTMs for HOXB8 Antibody (H00003218-M01)

Learn more about PTMs related to HOXB8 Antibody (H00003218-M01).

Blogs on HOXB8

There are no specific blogs for HOXB8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXB8 Antibody (4F8) and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXB8