HOXA4 Partial Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

HOXA4 Partial Recombinant Protein Summary

Description
HOXA4 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: DKSPLGLKGKEPVVYPWMKKIHVSAVNPSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKW
Gene
HOXA4

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXA4 Partial Recombinant Protein

  • homeo box A4
  • homeobox A4
  • Homeobox protein Hox-1.4
  • Homeobox protein Hox-1D
  • homeobox protein Hox-A4
  • HOX1
  • Hox-1.4-like protein
  • HOX1DDfd-like protein

Background

HOXA4 - homeo box A4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83235
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49631
Species: Hu
Applications: IHC
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
H00003204-M01
Species: Hu
Applications: WB, ELISA
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24663
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: IHC-P
H00003213-R01
Species: Hu
H00003216-R02
Species: Hu
NB100-92309
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52085
Species: Hu, Mu
Applications: WB, PEP-ELISA
H00003235-M01
Species: Hu, Mu
Applications: WB, ELISA
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45744
Species: Hu
Applications: WB, IHC
MAB80401
Species: Hu
Applications: WB
H00003221-M01
Species: Hu
Applications: WB, ELISA
NBP1-81718
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003231-M01
Species: Hu
Applications: WB, ELISA, IP
H00003206-R02
Species: Hu
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
H00003201-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for HOXA4 Partial Recombinant Protein (H00003201-Q01) (0)

There are no publications for HOXA4 Partial Recombinant Protein (H00003201-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXA4 Partial Recombinant Protein (H00003201-Q01) (0)

There are no reviews for HOXA4 Partial Recombinant Protein (H00003201-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXA4 Partial Recombinant Protein (H00003201-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HOXA4 Partial Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for HOXA4 Partial Recombinant Protein (H00003201-Q01)

Discover related pathways, diseases and genes to HOXA4 Partial Recombinant Protein (H00003201-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA4 Partial Recombinant Protein (H00003201-Q01)

Discover more about diseases related to HOXA4 Partial Recombinant Protein (H00003201-Q01).
 

Pathways for HOXA4 Partial Recombinant Protein (H00003201-Q01)

View related products by pathway.

PTMs for HOXA4 Partial Recombinant Protein (H00003201-Q01)

Learn more about PTMs related to HOXA4 Partial Recombinant Protein (H00003201-Q01).

Blogs on HOXA4

There are no specific blogs for HOXA4, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol HOXA4

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00003201-Q01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

HOXA9 Antibody
NBP2-24663
HOXA4 Antibody
NBP2-32515
HOXA4 Antibody
NBP2-32515
HOXA4 Antibody
NBP2-32515
HOXB4 Antibody
NBP2-24561
HOXB4 Antibody
NBP2-24561