Recombinant Human HOXA4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HOXA4 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 181 - 270 of Human HOXA4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DKSPLGLKGKEPVVYPWMKKIHVSAVNPSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKW

Protein/Peptide Type
Partial Recombinant Protein
Gene
HOXA4

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HOXA4 Protein

  • homeo box A4
  • homeobox A4
  • Homeobox protein Hox-1.4
  • Homeobox protein Hox-1D
  • homeobox protein Hox-A4
  • HOX1
  • Hox-1.4-like protein
  • HOX1DDfd-like protein

Background

HOXA4 - homeo box A4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
H00003204-M01
Species: Hu
Applications: WB, ELISA
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
NBP2-57662
Species: Hu
Applications: ICC/IF
NBL1-11673
Species: Hu
H00003223-M04
Species: Hu
Applications: WB, ELISA
NBP1-52085
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP2-55738
Species: Hu
Applications: ICC/IF
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-45744
Species: Hu
Applications: WB, IHC
NBP2-14098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56195
Species: Hu
Applications: WB, ICC/IF
NBP1-81718
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58710
Species: Hu
Applications: WB, ICC/IF
NBL1-11664
Species: Hu
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
H00003201-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for HOXA4 Partial Recombinant Protein (H00003201-Q01) (0)

There are no publications for HOXA4 Partial Recombinant Protein (H00003201-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXA4 Partial Recombinant Protein (H00003201-Q01) (0)

There are no reviews for HOXA4 Partial Recombinant Protein (H00003201-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXA4 Partial Recombinant Protein (H00003201-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HOXA4 Products

Bioinformatics Tool for HOXA4 Partial Recombinant Protein (H00003201-Q01)

Discover related pathways, diseases and genes to HOXA4 Partial Recombinant Protein (H00003201-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA4 Partial Recombinant Protein (H00003201-Q01)

Discover more about diseases related to HOXA4 Partial Recombinant Protein (H00003201-Q01).
 

Pathways for HOXA4 Partial Recombinant Protein (H00003201-Q01)

View related products by pathway.

PTMs for HOXA4 Partial Recombinant Protein (H00003201-Q01)

Learn more about PTMs related to HOXA4 Partial Recombinant Protein (H00003201-Q01).

Blogs on HOXA4

There are no specific blogs for HOXA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HOXA9 Antibody
NBP2-24633
HOXA4 Antibody
NBP2-32515
HOXB4 Antibody
NBP2-24561

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HOXA4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXA4