Recombinant Human HOOK3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HOOK3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 622-718 of Human HOOK3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QNQGAAPEIQALKNQLQERDRLFHSLEKEYEKTKSQREMEEKYIVSAWYNMGMTLHKKAAEDRLASTGSGQSFLARQRQATSSRRSYPGHVQPATAR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
HOOK3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HOOK3 Protein

  • FLJ31058
  • hHK3
  • HK3h-hook3
  • hook homolog 3 (Drosophila)
  • protein Hook homolog 3

Background

Hook proteins are cytosolic coiled-coil proteins that contain conserved N-terminal domains, which attach to microtubules, and more divergent C-terminal domains, which mediate binding to organelles. The Drosophila Hook protein is a component of the endocytic compartment.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4104
Species: Hu
Applications: WB, IP, Neut
NBP2-14986
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-180
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP
NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NBP2-02272
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
MAB2337
Species: Hu
Applications: WB, IP
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
AF2008
Species: Hu
Applications: WB, IHC, IP
NBP1-85789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81745
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89691
Species: Hu
Applications: IHC, IHC-P
AF2007
Species: Hu
Applications: WB
2626-SE
Species: Hu
NBP2-01833
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1595
Species: Hu
Applications: WB, IHC, IP
H00084376-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for HOOK3 Partial Recombinant Protein (H00084376-Q01) (0)

There are no publications for HOOK3 Partial Recombinant Protein (H00084376-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOOK3 Partial Recombinant Protein (H00084376-Q01) (0)

There are no reviews for HOOK3 Partial Recombinant Protein (H00084376-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOOK3 Partial Recombinant Protein (H00084376-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HOOK3 Products

Bioinformatics Tool for HOOK3 Partial Recombinant Protein (H00084376-Q01)

Discover related pathways, diseases and genes to HOOK3 Partial Recombinant Protein (H00084376-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOOK3 Partial Recombinant Protein (H00084376-Q01)

Discover more about diseases related to HOOK3 Partial Recombinant Protein (H00084376-Q01).
 

Pathways for HOOK3 Partial Recombinant Protein (H00084376-Q01)

View related products by pathway.

Blogs on HOOK3

There are no specific blogs for HOOK3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Kif2a Antibody
NB500-180
HOOK3 Antibody
NBP1-81743

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HOOK3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HOOK3