HNRNPUL2 Antibody - BSA Free

Immunohistochemistry-Paraffin: HNRNPUL2 Antibody [NBP1-92001] - Staining of human fallopian tube shows weak to moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: HNRNPUL2 Antibody [NBP1-92001] - Staining of human colon shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: HNRNPUL2 Antibody [NBP1-92001] - Staining of human cerebellum shows moderate to strong nuclear positivity in Purkinje cells.

Immunohistochemistry-Paraffin: HNRNPUL2 Antibody [NBP1-92001] - Staining of human small intestine shows moderate to strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: HNRNPUL2 Antibody [NBP1-92001] - Staining of human pancreas shows very weak nuclear positivity in exocrine glandular cells.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue

Analysis in human small intestine and pancreas tissues using NBP1-92001 antibody. Corresponding HNRNPUL2 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HNRNPUL2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HNRNPUL2 Antibody - BSA Free (NBP1-92001) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LPGSGKTQWALKYAKENPEKRYNVLGAETVLNQMRMKGLEEPEMDPKSRDLLVQQASQCLSKLVQIASRTKRNFIL
• Predicted Species: Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HNRNPUL2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HNRNPUL2 Protein (NBP1-92001PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HNRNPUL2 Antibody - BSA Free

• DKFZp762N1910
• heterogeneous nuclear ribonucleoprotein U-like 2
• heterogeneous nuclear ribonucleoprotein U-like protein 2
• HNRPUL2
• SAF-A2
• Scaffold-attachment factor A2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HNRNPUL2