HNRNPUL2 Antibody


Western Blot: HNRNPUL2 Antibody [NBP1-92001] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). more
Immunohistochemistry-Paraffin: HNRNPUL2 Antibody [NBP1-92001] - Staining of human fallopian tube shows weak to moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: HNRNPUL2 Antibody [NBP1-92001] - Staining of human colon shows strong nuclear positivity in glandular cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: HNRNPUL2 Antibody [NBP1-92001] - Analysis in human small intestine and pancreas tissues. Corresponding HNRNPUL2 RNA-seq data are presented for the same more
Immunohistochemistry-Paraffin: HNRNPUL2 Antibody [NBP1-92001] - Staining of human cerebellum shows moderate to strong nuclear positivity in Purkinje cells.
Immunohistochemistry-Paraffin: HNRNPUL2 Antibody [NBP1-92001] - Staining of human small intestine shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: HNRNPUL2 Antibody [NBP1-92001] - Staining of human pancreas shows very weak nuclear positivity in exocrine glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Validated by:

Orthogonal Strategies


Order Details

HNRNPUL2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LPGSGKTQWALKYAKENPEKRYNVLGAETVLNQMRMKGLEEPEMDPKSRDLLVQQASQCLSKLVQIASRTKRNFIL
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HNRNPUL2 Protein (NBP1-92001PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HNRNPUL2 Antibody

  • DKFZp762N1910
  • heterogeneous nuclear ribonucleoprotein U-like 2
  • heterogeneous nuclear ribonucleoprotein U-like protein 2
  • SAF-A2
  • Scaffold-attachment factor A2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, In vitro, KD, WB
Species: Mu
Applications: Bind, BA
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KD, KO, PAGE, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for HNRNPUL2 Antibody (NBP1-92001) (0)

There are no publications for HNRNPUL2 Antibody (NBP1-92001).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HNRNPUL2 Antibody (NBP1-92001) (0)

There are no reviews for HNRNPUL2 Antibody (NBP1-92001). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HNRNPUL2 Antibody (NBP1-92001) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HNRNPUL2 Antibody and receive a gift card or discount.


Gene Symbol HNRNPUL2