![Western Blot: HMGB4 Antibody [NBP2-83050] - WB Suggested Anti-HMGB4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Jurkat cell lysate](http://images.novusbio.com/fullsize/HMGB4-Antibody-Western-Blot-NBP2-83050-img0001.jpg "Western Blot: HMGB4 Antibody [NBP2-83050] - WB Suggested Anti-HMGB4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Jurkat cell lysate")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human HMGB4. Peptide sequence: WSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMSARNRCRG The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HMGB4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HMGB4 |
![Simple Western Casein Kinase 2 alpha Antibody (844720) [Unconjugated]](https://images.novusbio.com/images2/Casein_Kinase_2_alpha_MAB7957_Simple_Western_17150.jpg)
![Western Blot Casein Kinase 2 alpha Antibody (844720) [Unconjugated]](https://images.novusbio.com/images2/Casein_Kinase_2_alpha_MAB7957_Western_Blot_13018.jpg)
![Immunocytochemistry Casein Kinase 2 alpha Antibody (844720) [Unconjugated]](https://images.novusbio.com/images2/Casein_Kinase_2_alpha_MAB7957_Immunocytochemistry_13098.jpg)
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
