Histone H3.3 Antibody (5C5B8)

Western Blot: Histone H3.3 Antibody (5C5B8) [NBP3-16489] - Western blot analysis of extracts of various cell lines, using Histone H3.3 Rabbit mAb (NBP3-16489) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Western Blot: Histone H3.3 Antibody (5C5B8) [NBP3-16489] - Western blot analysis of extracts of Rat lung, using Histone H3.3 Rabbit mAb (NBP3-16489) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunohistochemistry-Paraffin: Histone H3.3 Antibody (5C5B8) [NBP3-16489] - Immunohistochemistry of paraffin-embedded rat kidney using Histone H3.3 Rabbit mAb (NBP3-16489) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Histone H3.3 Antibody (5C5B8) [NBP3-16489] - Immunohistochemistry of paraffin-embedded human esophageal using Histone H3.3 Rabbit mAb (NBP3-16489) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Chromatin Immunoprecipitation: Histone H3.3 Antibody (5C5B8) [Histone H3.3] - Chromatin immunoprecipitations were performed with cross-linked chromatin from HeLa cells and Histone H3.3 Rabbit mAb . The ChIP sequencing results indicate the enrichment pattern of Histone H3.3 in selected genomic region and representative gene loci (GAPDH), as shown in figure.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC, ChIP
• Clone: 5C5B8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Histone H3.3 Antibody (5C5B8) Summary

• Description: Novus Biologicals Rabbit Histone H3.3 Antibody (5C5B8) (NBP3-16489) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ChIP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 57-136 of human Histone H3.3 (P84243). KSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: H3-3A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP) 2μg antibody for 5μg-10μg of Chromatin
  • Chromatin Immunoprecipitation Sequencing 1:50 - 1:200
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunohistochemistry 1:200 - 1:2000
  • Immunohistochemistry-Paraffin 1:200 - 1:2000
  • Western Blot 1:1000 - 1:6000
• Theoretical MW: 15 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Wide Range Predicted

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Histone H3.3 Antibody (5C5B8)

• H3.3A
• H3F3
• H3F3A
• Histone H3.3
• Histone H3.3A
• Histone H3.3B
• MGC87782
• MGC87783

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: H3-3A