HIST1H3D Antibody (1D8)


Western Blot: HIST1H3D Antibody (1D8) [H00008351-M01] - HIST1H3D monoclonal antibody (M01), clone 1D8. Analysis of HIST1H3D expression in Raw 264.7.
Immunocytochemistry/ Immunofluorescence: HIST1H3D Antibody (1D8) [H00008351-M01] - Analysis of monoclonal antibody to HIST1H3D on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: HIST1H3D Antibody (1D8) [H00008351-M01] - Analysis of monoclonal antibody to HIST1H3D on formalin-fixed paraffin-embedded human lateral ventricle wall. Antibody concentration 3 ug/ml.
Western Blot: HIST1H3D Antibody (1D8) [H00008351-M01] - HIST1H3D monoclonal antibody (M01), clone 1D8 Analysis of HIST1H3D expression in Hela S3 NE.
Western Blot: HIST1H3D Antibody (1D8) [H00008351-M01] - HIST1H3D monoclonal antibody (M01), clone 1D8. Analysis of HIST1H3D expression in NIH/3T3.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P

Order Details

HIST1H3D Antibody (1D8) Summary

HIST1H3D (NP_003521, 1 a.a. - 60 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
HIST1H3D (1D8)
IgG3 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Read Publication using H00008351-M01.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HIST1H3D Antibody (1D8)

  • H3 histone family, member L
  • H3/l
  • H3FA
  • H3FB
  • H3FC
  • H3FD
  • H3FF
  • H3FH
  • H3FI
  • H3FJ
  • H3FK
  • HIST1H3A
  • HIST1H3C
  • HIST1H3D
  • HIST1H3F
  • HIST1H3G
  • HIST1H3H
  • HIST1H3I
  • HIST1H3J
  • histone 1, H3b
  • histone cluster 1, H3b
  • histone H3.1
  • Histone H3/a
  • Histone H3/b
  • Histone H3/c
  • Histone H3/d
  • Histone H3/f
  • Histone H3/h
  • Histone H3/i
  • Histone H3/j
  • Histone H3/k
  • Histone H3/l


Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H3 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Ce
Applications: WB, ChIP, DB, ICC/IF
Species: Hu
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Xp
Applications: WB, ELISA, ICC/IF, IHC-P, KO
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, IHC-P
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IP, KO
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA

Publications for HIST1H3D Antibody (H00008351-M01)(1)

Reviews for HIST1H3D Antibody (H00008351-M01) (0)

There are no reviews for HIST1H3D Antibody (H00008351-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HIST1H3D Antibody (H00008351-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for HIST1H3D Antibody (H00008351-M01)

Discover related pathways, diseases and genes to HIST1H3D Antibody (H00008351-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HIST1H3D Antibody (H00008351-M01)

Discover more about diseases related to HIST1H3D Antibody (H00008351-M01).

Pathways for HIST1H3D Antibody (H00008351-M01)

View related products by pathway.

PTMs for HIST1H3D Antibody (H00008351-M01)

Learn more about PTMs related to HIST1H3D Antibody (H00008351-M01).

Blogs on HIST1H3D

There are no specific blogs for HIST1H3D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HIST1H3D Antibody (1D8) and receive a gift card or discount.


Gene Symbol HIST1H3D