Histone H1.4 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Rabbit Histone H1.4 Antibody - Azide and BSA Free (NBP3-16044) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H14 (NP_005312.1). MSETAPAAPAAPAPAEKTPVKKKARKSAGAAKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
H1-4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.05% Proclin 300 |
| Purity |
Affinity purified |
Alternate Names for Histone H1.4 Antibody - Azide and BSA Free
Background
The HIST1H1E gene encodes a 219 amino acid long, 21 kDA Histone H1.4 that functions by binding to linker DNA between nucleosome creating the macromolecular structure chromatin fiber. H1 histones as especially critical in condensation of nucleosome chains and the monitoring of individual gene transcription. HIST1H1E participates in PKA signaling, cell cycle start of DNA replication in early S phase, apoptosis, and histone modification. It interacts with genes HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, and HIST1H4L. HIST1H1E has been researched regarding its role in progressive supranuclear palsy, pancreatitis, hepatitis, and x inactivation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow-IC, ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, , WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu, Mu
Applications: ICC, WB
Species: Hu
Applications: WB
Publications for Histone H1.4 Antibody (NBP3-16044) (0)
There are no publications for Histone H1.4 Antibody (NBP3-16044).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Histone H1.4 Antibody (NBP3-16044) (0)
There are no reviews for Histone H1.4 Antibody (NBP3-16044).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Histone H1.4 Antibody (NBP3-16044) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Histone H1.4 Products
Research Areas for Histone H1.4 Antibody (NBP3-16044)
Find related products by research area.
|
Blogs on Histone H1.4