Recombinant Human Histone H1.1 GST (N-Term) Protein

Images

 
Recombinant Human Histone H1.1 Protein [H00003024-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related Histone H1.1 Peptides and Proteins

Order Details


    • Catalog Number
      H00003024-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Histone H1.1 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-215 of Human HIST1H1A

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
H1-1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
48.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Histone H1.1 GST (N-Term) Protein

  • H1 histone family, member 1
  • H1.1
  • H1A
  • H1F1HIST1
  • histone 1, H1a
  • histone cluster 1, H1a
  • histone H1.1
  • MGC126642
  • MGC138345

Background

Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H1 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45184
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-17162
Species: Hu
Applications: IHC, IHC-P
NBP3-46117
Species: Hu, Mu
Applications: ELISA, WB
H00008337-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-44999
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-14260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-47752
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, WB
NLS3775
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37253
Species: Hu
Applications: ELISA, ICC/IF, WB

Publications for Histone H1.1 Recombinant Protein (H00003024-P01) (0)

There are no publications for Histone H1.1 Recombinant Protein (H00003024-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histone H1.1 Recombinant Protein (H00003024-P01) (0)

There are no reviews for Histone H1.1 Recombinant Protein (H00003024-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Histone H1.1 Recombinant Protein (H00003024-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Histone H1.1 Products

Research Areas for Histone H1.1 Recombinant Protein (H00003024-P01)

Find related products by research area.

Blogs on Histone H1.1

There are no specific blogs for Histone H1.1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Histone H1.1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol H1-1