Recombinant Human HIST1H3G Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human HIST1H3G Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-60 of Human HIST1H3G

Source: Wheat Germ

Amino Acid Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
HIST1H3G
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
32.34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HIST1H3G Protein

  • H3 histone family, member H
  • H3/h
  • H3FA
  • H3FB
  • H3FC
  • H3FD
  • H3FF
  • H3FHHIST1H3D
  • H3FI
  • H3FJ
  • H3FK
  • H3FL
  • HIST1H3A
  • HIST1H3B
  • HIST1H3C
  • HIST1H3E
  • HIST1H3F
  • HIST1H3H
  • HIST1H3I
  • HIST1H3J
  • histone 1, H3g
  • histone cluster 1, H3g
  • histone H3.1
  • Histone H3/a
  • Histone H3/b
  • Histone H3/c
  • Histone H3/d
  • Histone H3/f
  • Histone H3/h
  • Histone H3/i
  • Histone H3/j
  • Histone H3/k
  • Histone H3/l

Background

HIST1H3G - histone 1, H3g

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB21-1023
Species: Hu, Mu, Ce
Applications: WB, ChIP, DB, ICC/IF
NBP2-07996
Species: Hu
NBP2-52487
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003021-M01
Species: Hu, Mu, Xp
Applications: WB, ELISA, ICC/IF, IHC-P, KO
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-38636
Species: Hu
Applications: IHC, IHC-P
NBP2-52483
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP, KO
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
H00008337-P01
Species: Hu
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P, KD
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-38442
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA

Publications for HIST1H3G Partial Recombinant Protein (H00008355-Q01) (0)

There are no publications for HIST1H3G Partial Recombinant Protein (H00008355-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIST1H3G Partial Recombinant Protein (H00008355-Q01) (0)

There are no reviews for HIST1H3G Partial Recombinant Protein (H00008355-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HIST1H3G Partial Recombinant Protein (H00008355-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HIST1H3G Products

Bioinformatics Tool for HIST1H3G Partial Recombinant Protein (H00008355-Q01)

Discover related pathways, diseases and genes to HIST1H3G Partial Recombinant Protein (H00008355-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on HIST1H3G

There are no specific blogs for HIST1H3G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATRX Antibody
NBP1-83077

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HIST1H3G Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HIST1H3G