Recombinant Human HIST1H3G GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human HIST1H3G Protein [H00008355-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human HIST1H3G GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-60 of Human HIST1H3G

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
HIST1H3G
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
32.34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HIST1H3G GST (N-Term) Protein

  • H3 histone family, member H
  • H3/h
  • H3FA
  • H3FB
  • H3FC
  • H3FD
  • H3FF
  • H3FHHIST1H3D
  • H3FI
  • H3FJ
  • H3FK
  • H3FL
  • HIST1H3A
  • HIST1H3B
  • HIST1H3C
  • HIST1H3E
  • HIST1H3F
  • HIST1H3H
  • HIST1H3I
  • HIST1H3J
  • histone 1, H3g
  • histone cluster 1, H3g
  • histone H3.1
  • Histone H3/a
  • Histone H3/b
  • Histone H3/c
  • Histone H3/d
  • Histone H3/f
  • Histone H3/h
  • Histone H3/i
  • Histone H3/j
  • Histone H3/k
  • Histone H3/l

Background

HIST1H3G - histone 1, H3g

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-06572
Species: Hu
Applications: WB
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-85351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NLS3775
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
H00003021-M01
Species: Bv, Dr, Hu, Mu, Xp
Applications: ELISA, ICC/IF, IHC, IHC-P, KO, WB
NBP2-24697
Species: Bv, Ch, Dr, Eq, Hu, Mu, Ma-Op, Ze
Applications: IHC, IHC-P, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP3-04894
Species: Hu
Applications: IHC, IHC-P, KO, WB
NBP2-52483
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow, WB
H00029883-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NB500-212
Species: Hu
Applications: ICC/IF, IP, KD, WB
NB100-56346
Species: Hu, Mu, Sh
Applications: ELISA, Flow, IHC, IHC-P, WB
H00008337-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-83077
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB500-207
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-76978
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-59787
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB

Publications for HIST1H3G Partial Recombinant Protein (H00008355-Q01) (0)

There are no publications for HIST1H3G Partial Recombinant Protein (H00008355-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIST1H3G Partial Recombinant Protein (H00008355-Q01) (0)

There are no reviews for HIST1H3G Partial Recombinant Protein (H00008355-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HIST1H3G Partial Recombinant Protein (H00008355-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HIST1H3G Products

Array H00008355-Q01

Bioinformatics Tool for HIST1H3G Partial Recombinant Protein (H00008355-Q01)

Discover related pathways, diseases and genes to HIST1H3G Partial Recombinant Protein (H00008355-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on HIST1H3G

There are no specific blogs for HIST1H3G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HIST1H3G GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HIST1H3G