HGSNAT Antibody

Images

 
Immunohistochemistry-Paraffin: HGSNAT Antibody [NBP1-81990] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HGSNAT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QALLLIHNELLWTNLTVYWKSECCYHCLFQVLVNVPQSPKAGKPSAAAASVSTQHGSILQLNDTLEEKEVCRLEYRFGEFGNYSLLVKNIHNGVSEIACDLAVN
Specificity
Specificity of human HGSNAT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HGSNAT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HGSNAT Protein (NBP1-81990PEP)
Publications
Read Publication using
NBP1-81990 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25491247).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HGSNAT Antibody

  • heparan-alpha-glucosaminide N-acetyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31555
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83164
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86084
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-31631
Species: Hu
Applications: IHC, IHC-P

Publications for HGSNAT Antibody (NBP1-81990)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for HGSNAT Antibody (NBP1-81990) (0)

There are no reviews for HGSNAT Antibody (NBP1-81990). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HGSNAT Antibody (NBP1-81990) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP1-81990

Bioinformatics Tool for HGSNAT Antibody (NBP1-81990)

Discover related pathways, diseases and genes to HGSNAT Antibody (NBP1-81990). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HGSNAT Antibody (NBP1-81990)

Discover more about diseases related to HGSNAT Antibody (NBP1-81990).
 

Pathways for HGSNAT Antibody (NBP1-81990)

View related products by pathway.

PTMs for HGSNAT Antibody (NBP1-81990)

Learn more about PTMs related to HGSNAT Antibody (NBP1-81990).

Blogs on HGSNAT

There are no specific blogs for HGSNAT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HGSNAT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HGSNAT