![Immunohistochemistry-Paraffin: HGSNAT Antibody [NBP1-81990] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.](http://images.novusbio.com/fullsize2/HGSNAT-Antibody-Immunohistochemistry-Paraffin-NBP1-81990-img0007.jpg "Immunohistochemistry-Paraffin: HGSNAT Antibody [NBP1-81990] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QALLLIHNELLWTNLTVYWKSECCYHCLFQVLVNVPQSPKAGKPSAAAASVSTQHGSILQLNDTLEEKEVCRLEYRFGEFGNYSLLVKNIHNGVSEIACDLAVN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HGSNAT |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB reported in scientific literature (PMID: 25491247). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry/Immunofluorescence: alpha-N-acetylglucosaminidase/NAGLU Antibody [NBP1-31555] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: NAGLU protein stained by NAGLU antibody diluted at 1:500. Blue: Hoechst 33342 staining.](http://images.novusbio.com/images2/alpha-N-acetylglucosaminidase-NAGLU-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-31555-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: alpha-N-acetylglucosaminidase/NAGLU Antibody [NBP1-31555] - U-87 MG cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: NAGLU protein stained by NAGLU antibody diluted at 1:250. Blue: Hoechst 33342 staining.](http://images.novusbio.com/images2/alpha-N-acetylglucosaminidase-NAGLU-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-31555-img0004.jpg)
![Immunohistochemistry-Paraffin: alpha-N-acetylglucosaminidase/NAGLU Antibody [NBP1-31555] - Paraffin-embedded rat brain. Green: NAGLU antibody iluted at 1:200. The signal was developed using goat anti-rabbit IgG antibody (Dylight488). Blue: Nuclear staining with Hoechst 33342.](http://images.novusbio.com/images2/alpha-N-acetylglucosaminidase-NAGLU-Antibody-Immunohistochemistry-Paraffin-NBP1-31555-img0006.jpg)
![Western Blot: Sulfamidase/SGSH Antibody [NBP1-83164] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-522](http://images.novusbio.com/images2/Sulfamidase-SGSH-Antibody-Western-Blot-NBP1-83164-img0004.jpg)
![Immunohistochemistry-Paraffin: Sulfamidase/SGSH Antibody [NBP1-83164] - Analysis in human adrenal gland and skeletal muscle tissues. Corresponding SGSH RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/Sulfamidase-SGSH-Antibody-Immunohistochemistry-Paraffin-NBP1-83164-img0011.jpg)
![Immunohistochemistry-Paraffin: Sulfamidase/SGSH Antibody [NBP1-83164] - Staining of human adrenal gland shows strong cytoplasmic granular positivity in glandular cells.](http://images.novusbio.com/images2/Sulfamidase-SGSH-Antibody-Immunohistochemistry-Paraffin-NBP1-83164-img0012.jpg)
![Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody [Unconjugated]")
| Publication using NBP1-81990 | Applications | Species |
|---|---|---|
| Matos L, Canals I, Dridi L et al. Therapeutic strategies based on modified U1 snRNAs and chaperones for Sanfilippo C splicing mutations. Orphanet J Rare Dis 2014 Dec 10 [PMID: 25491247] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for HGSNAT Antibody (NBP1-81990)Discover more about diseases related to HGSNAT Antibody (NBP1-81990).
| Pathways for HGSNAT Antibody (NBP1-81990)View related products by pathway.
|
PTMs for HGSNAT Antibody (NBP1-81990)Learn more about PTMs related to HGSNAT Antibody (NBP1-81990).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HGSNAT |
![Immunohistochemistry-Paraffin: HGSNAT Antibody [NBP1-81990] - Analysis in human fallopian tube and skeletal muscle tissues. Corresponding HGSNAT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/HGSNAT-Antibody-Immunohistochemistry-Paraffin-NBP1-81990-img0003.jpg "Immunohistochemistry-Paraffin: HGSNAT Antibody [NBP1-81990] - Analysis in human fallopian tube and skeletal muscle tissues. Corresponding HGSNAT RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: HGSNAT Antibody [NBP1-81990] - Staining of human Fallopian tube shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize2/HGSNAT-Antibody-Immunohistochemistry-Paraffin-NBP1-81990-img0004.jpg "Immunohistochemistry-Paraffin: HGSNAT Antibody [NBP1-81990] - Staining of human Fallopian tube shows strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: HGSNAT Antibody [NBP1-81990] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize2/HGSNAT-Antibody-Immunohistochemistry-Paraffin-NBP1-81990-img0005.jpg "Immunohistochemistry-Paraffin: HGSNAT Antibody [NBP1-81990] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: HGSNAT Antibody [NBP1-81990] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/HGSNAT-Antibody-Immunohistochemistry-Paraffin-NBP1-81990-img0006.jpg "Immunohistochemistry-Paraffin: HGSNAT Antibody [NBP1-81990] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.")
![Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.](http://images.novusbio.com/images2/Glutaminyl-peptide-Cyclotransferase-QPCT-Antibody-Western-Blot-NBP1-81838-img0006.jpg)
![Immunohistochemistry: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human adrenal gland shows high expression.](http://images.novusbio.com/images2/Glutaminyl-peptide-Cyclotransferase-QPCT-Antibody-Immunohistochemistry-NBP1-81838-img0008.jpg)
![Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/images2/Glutaminyl-peptide-Cyclotransferase-QPCT-Antibody-Immunohistochemistry-Paraffin-NBP1-81838-img0009.jpg)
![Immunohistochemistry-Paraffin: MTSS1 Antibody [NBP2-24716] - Analysis of human colon using this antibody at 10 ug/ml.](http://images.novusbio.com/images2/MTSS1-Antibody-Immunohistochemistry-Paraffin-NBP2-24716-img0004.jpg)
![Western Blot: MTSS1 Antibody [NBP2-24716] - Analysis of MTSS1 in human testis lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse and 4) rat testis lysate using NBP2-24716 at 2 ug/ml, 4 ug/ml and 2 ug/ml, respectively.](http://images.novusbio.com/images2/MTSS1-Antibody-Western-Blot-NBP2-24716-img0005.jpg)
