Recombinant Human HBO1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HBO1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 512-611 of Human MYST2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
KAT7

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HBO1 Protein

  • HBO1EC 2.3.1.48
  • HBOA
  • Histone acetyltransferase binding to ORC1
  • histone acetyltransferase MYST2
  • KAT7
  • MOZ, YBF2/SAS3, SAS2 and TIP60 protein 2
  • MYST histone acetyltransferase 2
  • MYST-2

Background

MYST2 - MYST histone acetyltransferase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-28879
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NBL1-11569
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NBP1-80324
Species: Hu
Applications: WB
H00051147-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP2-57745
Species: Hu
Applications: ICC/IF, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00051053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-55900
Species: Hu
Applications: WB, ICC/IF
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-2567
Species: Hu
Applications: WB, IHC-P, IP

Publications for HBO1 Partial Recombinant Protein (H00011143-Q01) (0)

There are no publications for HBO1 Partial Recombinant Protein (H00011143-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HBO1 Partial Recombinant Protein (H00011143-Q01) (0)

There are no reviews for HBO1 Partial Recombinant Protein (H00011143-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HBO1 Partial Recombinant Protein (H00011143-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HBO1 Products

Bioinformatics Tool for HBO1 Partial Recombinant Protein (H00011143-Q01)

Discover related pathways, diseases and genes to HBO1 Partial Recombinant Protein (H00011143-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HBO1 Partial Recombinant Protein (H00011143-Q01)

Discover more about diseases related to HBO1 Partial Recombinant Protein (H00011143-Q01).
 

Pathways for HBO1 Partial Recombinant Protein (H00011143-Q01)

View related products by pathway.

PTMs for HBO1 Partial Recombinant Protein (H00011143-Q01)

Learn more about PTMs related to HBO1 Partial Recombinant Protein (H00011143-Q01).
 

Research Areas for HBO1 Partial Recombinant Protein (H00011143-Q01)

Find related products by research area.

Blogs on HBO1

There are no specific blogs for HBO1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HBO1 Antibody
NBP1-92161
CDT1 Antibody
NB100-2567

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HBO1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KAT7