HBO1 Antibody [PerCP] Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 55-193 of human HBO1 (NP_008998.1).
Sequence: DSSPVRNLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTADHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYNFNMKCPTPGCNSL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KAT7 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
PBS |
| Preservative |
0.05% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for HBO1 Antibody [PerCP]
Background
HBO1 (human acetylase binding to ORC1) is a MYST family histone acetylase. HBO1 has shown to be targeted to origins of replication in association with the licensing factor Cdt1 and to also interact with transcriptional activator proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: EnzAct
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, , WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Publications for HBO1 Antibody (NBP3-38191PCP) (0)
There are no publications for HBO1 Antibody (NBP3-38191PCP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HBO1 Antibody (NBP3-38191PCP) (0)
There are no reviews for HBO1 Antibody (NBP3-38191PCP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HBO1 Antibody (NBP3-38191PCP) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HBO1 Products
Research Areas for HBO1 Antibody (NBP3-38191PCP)
Find related products by research area.
|
Blogs on HBO1