H1FX Antibody

Images

 
Western Blot: H1FX Antibody [H00008971-B01P] - Analysis of H1FX expression in human placenta.
Immunocytochemistry/ Immunofluorescence: H1FX Antibody [H00008971-B01P] - Analysis of purified antibody to H1FX on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: H1FX Antibody [H00008971-B01P] - Analysis of H1FX expression in transfected 293T cell line by H1FX polyclonal antibody. Lane 1: H1FX transfected lysate(23.43 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

H1FX Antibody Summary

Immunogen
H1FX (NP_006017.1, 1 a.a. - 213 a.a.) full-length human protein. MSVELEEALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEGGGERRGAPAAATAPAPTAHKAKKAAPGAAGSRRADKKPARGQKPEQRSHKKGAGAKKDKGGKAKKTAAAGGKKVKKAAKPSVPKVPKGRK
Specificity
H1FX - H1 histone family, member X,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
H1FX
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for H1FX Antibody

  • H1 histone family, member X
  • H1X
  • histone H1x
  • MGC15959
  • MGC8350

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a member of the histone H1 family. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-58095
Species: Hu
Applications: WB
NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81533
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-P, IM
NBP2-49202
Species: Hu
Applications: IHC
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83054
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008971-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for H1FX Antibody (H00008971-B01P) (0)

There are no publications for H1FX Antibody (H00008971-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for H1FX Antibody (H00008971-B01P) (0)

There are no reviews for H1FX Antibody (H00008971-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for H1FX Antibody (H00008971-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional H1FX Products

Bioinformatics Tool for H1FX Antibody (H00008971-B01P)

Discover related pathways, diseases and genes to H1FX Antibody (H00008971-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for H1FX Antibody (H00008971-B01P)

View related products by pathway.

PTMs for H1FX Antibody (H00008971-B01P)

Learn more about PTMs related to H1FX Antibody (H00008971-B01P).

Blogs on H1FX

There are no specific blogs for H1FX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our H1FX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol H1FX
Entrez
Uniprot