H1FX Antibody - Azide and BSA Free

Western Blot: H1FX Antibody [H00008971-B01P] - Analysis of H1FX expression in human placenta.

Immunocytochemistry/Immunofluorescence: H1FX Antibody [H00008971-B01P] - Analysis of purified antibody to H1FX on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: H1FX Antibody [H00008971-B01P] - Analysis of H1FX expression in transfected 293T cell line by H1FX polyclonal antibody. Lane 1: H1FX transfected lysate(23.43 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

H1FX Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: H1FX (NP_006017.1, 1 a.a. - 213 a.a.) full-length human protein. MSVELEEALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEGGGERRGAPAAATAPAPTAHKAKKAAPGAAGSRRADKKPARGQKPEQRSHKKGAGAKKDKGGKAKKTAAAGGKKVKKAAKPSVPKVPKGRK
• Specificity: H1FX - H1 histone family, member X,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: H1-10
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for H1FX Antibody - Azide and BSA Free

• H1 histone family, member X
• H1X
• histone H1x
• MGC15959
• MGC8350

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a member of the histone H1 family. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: H1-10
• Entrez:
  • 8971(Human)
• Uniprot:
  • NP_006017.1(Human)