GTSF1 Antibody


Western Blot: GTSF1 Antibody [NBP2-32625] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with more
Immunocytochemistry/ Immunofluorescence: GTSF1 Antibody [NBP2-32625] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry: GTSF1 Antibody [NBP2-32625] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

GTSF1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: QTRSLRQETLAESTWQCPPCDEDWDKDLWEQTSTPFVWGTTHYSDNNSPASNIVTEHKNNLASGMRVPKSLPYV
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GTSF1 Protein (NBP2-32625PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GTSF1 Antibody

  • FAM112B
  • family with sequence similarity 112, member B
  • FLJ32942
  • gametocyte specific factor 1
  • gametocyte-specific factor 1
  • Protein FAM112B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP, CyTOF-ready, Flow-CS
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GTSF1 Antibody (NBP2-32625) (0)

There are no publications for GTSF1 Antibody (NBP2-32625).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTSF1 Antibody (NBP2-32625) (0)

There are no reviews for GTSF1 Antibody (NBP2-32625). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GTSF1 Antibody (NBP2-32625) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GTSF1 Products

Bioinformatics Tool for GTSF1 Antibody (NBP2-32625)

Discover related pathways, diseases and genes to GTSF1 Antibody (NBP2-32625). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTSF1 Antibody (NBP2-32625)

Discover more about diseases related to GTSF1 Antibody (NBP2-32625).

Pathways for GTSF1 Antibody (NBP2-32625)

View related products by pathway.

PTMs for GTSF1 Antibody (NBP2-32625)

Learn more about PTMs related to GTSF1 Antibody (NBP2-32625).

Blogs on GTSF1

There are no specific blogs for GTSF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GTSF1 Antibody and receive a gift card or discount.


Gene Symbol GTSF1