GTSF1 Antibody


Western Blot: GTSF1 Antibody [NBP1-83934] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a more
Immunohistochemistry-Paraffin: GTSF1 Antibody [NBP1-83934] - Staining of human testis shows strong nuclear positivity in seminiferous ducts.

Product Details

Reactivity Hu, Mouse, RatSpecies Glossary
Applications WB, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

GTSF1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:DPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISSCDDRSCIEQDVVNQ
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
GTSF1 Protein (NBP1-83934PEP)

Alternate Names for GTSF1 Antibody

  • FAM112B
  • family with sequence similarity 112, member B
  • FLJ32942
  • gametocyte specific factor 1
  • gametocyte-specific factor 1
  • Protein FAM112B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, S-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for GTSF1 Antibody (NBP1-83934) (0)

There are no publications for GTSF1 Antibody (NBP1-83934).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTSF1 Antibody (NBP1-83934) (0)

There are no reviews for GTSF1 Antibody (NBP1-83934). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GTSF1 Antibody (NBP1-83934). (Showing 1 - 1 of 1 FAQ).

  1. Can GTSF1 antibody (NBP1-83934) be used with zebrafish ?
    • Our GTSF1 antibody NBP1-83934 shares 61% homology to the Zebrafish protein Uniprot. Since this species has not yet been tested, we can offer you our Innovator's Reward Program if you would like to try this antibody in your experiment. Our Innovator’s Reward™ program was created to allow researchers the opportunity to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply submit an online review detailing your positive or negative results. In return, you receive a discount voucher for 100% of the purchase price of the reviewed product.

Secondary Antibodies


Isotype Controls

Additional GTSF1 Antibody Products

Related Products by Gene

Bioinformatics Tool for GTSF1 Antibody (NBP1-83934)

Discover related pathways, diseases and genes to GTSF1 Antibody (NBP1-83934). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTSF1 Antibody (NBP1-83934)

Discover more about diseases related to GTSF1 Antibody (NBP1-83934).

Pathways for GTSF1 Antibody (NBP1-83934)

View related products by pathway.

PTMs for GTSF1 Antibody (NBP1-83934)

Learn more about PTMs related to GTSF1 Antibody (NBP1-83934).

Blogs on GTSF1

There are no specific blogs for GTSF1, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol GTSF1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-83934 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought