GTSF1 Antibody

Images

 
Western Blot: GTSF1 Antibody [NBP1-83934] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: GTSF1 Antibody [NBP1-83934] - Staining of human testis shows strong nuclear positivity in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GTSF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISSCDDRSCIEQDVVNQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GTSF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GTSF1 Protein (NBP1-83934PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GTSF1 Antibody

  • FAM112B
  • family with sequence similarity 112, member B
  • FLJ32942
  • gametocyte specific factor 1
  • gametocyte-specific factor 1
  • Protein FAM112B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46193
Species: Hu
Applications: WB, IHC
NB100-56390
Species: Mu
Applications: WB
NBP1-91787
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37387
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
AF3040
Species: Hu
Applications: WB
NBP2-31106
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP, CyTOF-ready, Flow-CS
NBP1-90335
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14214
Species: Hu
Applications: IHC, IHC-P
NBP1-83934
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for GTSF1 Antibody (NBP1-83934) (0)

There are no publications for GTSF1 Antibody (NBP1-83934).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTSF1 Antibody (NBP1-83934) (0)

There are no reviews for GTSF1 Antibody (NBP1-83934). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GTSF1 Antibody (NBP1-83934). (Showing 1 - 1 of 1 FAQ).

  1. Can GTSF1 antibody (NBP1-83934) be used with zebrafish ?
    • Our GTSF1 antibody NBP1-83934 shares 61% homology to the Zebrafish protein Uniprot. Since this species has not yet been tested, we can offer you our Innovator's Reward Program if you would like to try this antibody in your experiment. Our Innovator’s Reward™ program was created to allow researchers the opportunity to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply submit an online review detailing your positive or negative results. In return, you receive a discount voucher for 100% of the purchase price of the reviewed product.

Secondary Antibodies

 

Isotype Controls

Additional GTSF1 Products

Bioinformatics Tool for GTSF1 Antibody (NBP1-83934)

Discover related pathways, diseases and genes to GTSF1 Antibody (NBP1-83934). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTSF1 Antibody (NBP1-83934)

Discover more about diseases related to GTSF1 Antibody (NBP1-83934).
 

Pathways for GTSF1 Antibody (NBP1-83934)

View related products by pathway.

PTMs for GTSF1 Antibody (NBP1-83934)

Learn more about PTMs related to GTSF1 Antibody (NBP1-83934).

Blogs on GTSF1

There are no specific blogs for GTSF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GTSF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GTSF1