GTSF1 Antibody - BSA Free

Immunohistochemistry-Paraffin: GTSF1 Antibody [NBP1-83934] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: GTSF1 Antibody [NBP1-83934] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: GTSF1 Antibody [NBP1-83934] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

Immunohistochemistry-Paraffin: GTSF1 Antibody [NBP1-83934] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.

Analysis in human cell line NB4.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GTSF1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GTSF1 Antibody - BSA Free (NBP1-83934) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISSCDDRSCIEQDVVNQ
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GTSF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 1:100-1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GTSF1 Protein (NBP1-83934PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GTSF1 Antibody - BSA Free

• FAM112B
• family with sequence similarity 112, member B
• FLJ32942
• gametocyte specific factor 1
• gametocyte-specific factor 1
• Protein FAM112B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for GTSF1 Antibody (NBP1-83934). (Showing 1 - 1 of 1 FAQ).

1. Can GTSF1 antibody (NBP1-83934) be used with zebrafish ?
   • Our GTSF1 antibody NBP1-83934 shares 61% homology to the Zebrafish protein Uniprot. Since this species has not yet been tested, we can offer you our Innovator's Reward Program if you would like to try this antibody in your experiment. Our Innovator’s Reward™ program was created to allow researchers the opportunity to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply submit an online review detailing your positive or negative results. In return, you receive a discount voucher for 100% of the purchase price of the reviewed product.

Bioinformatics

• Gene Symbol: GTSF1