Recombinant Human GSPT1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human GSPT1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 390-499 of Human GSPT1

Source: Wheat Germ

Amino Acid Sequence: GRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
GSPT1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GSPT1 Protein

  • ERF3A
  • eRF3aFLJ38048
  • ETF3A
  • eukaryotic peptide chain release factor GTP-binding subunit ERF3A
  • Eukaryotic peptide chain release factor subunit 3a
  • FLJ39067
  • G1 to S phase transition 1,551G9.2
  • G1 to S phase transition protein 1 homolog
  • GST1

Background

GSPT1 - G1 to S phase transition 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-91971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32157
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82653
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-59944
Species: Hu
Applications: WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91748
Species: Hu
Applications: IHC, IHC-P
NBP1-88667
Species: Hu
Applications: IHC, IHC-P
AF5059
Species: Hu
Applications: WB, IHC
H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-57731
Species: Hu
Applications: WB, ICC/IF

Publications for GSPT1 Partial Recombinant Protein (H00002935-Q01) (0)

There are no publications for GSPT1 Partial Recombinant Protein (H00002935-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GSPT1 Partial Recombinant Protein (H00002935-Q01) (0)

There are no reviews for GSPT1 Partial Recombinant Protein (H00002935-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GSPT1 Partial Recombinant Protein (H00002935-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GSPT1 Products

Bioinformatics Tool for GSPT1 Partial Recombinant Protein (H00002935-Q01)

Discover related pathways, diseases and genes to GSPT1 Partial Recombinant Protein (H00002935-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSPT1 Partial Recombinant Protein (H00002935-Q01)

Discover more about diseases related to GSPT1 Partial Recombinant Protein (H00002935-Q01).
 

Pathways for GSPT1 Partial Recombinant Protein (H00002935-Q01)

View related products by pathway.

PTMs for GSPT1 Partial Recombinant Protein (H00002935-Q01)

Learn more about PTMs related to GSPT1 Partial Recombinant Protein (H00002935-Q01).
 

Research Areas for GSPT1 Partial Recombinant Protein (H00002935-Q01)

Find related products by research area.

Blogs on GSPT1

There are no specific blogs for GSPT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GSPT1 Antibody
NBP2-16754

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GSPT1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GSPT1