GRK6 Antibody (8B7)

Images

 
Western Blot: GRK6 Antibody (8B7) [H00002870-M07] - Analysis of GRK6 expression in A-431 (Cat # L015V1).
Sandwich ELISA: GRK6 Antibody (8B7) [H00002870-M07] - Detection limit for recombinant GST tagged GRK6 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
8B7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GRK6 Antibody (8B7) Summary

Immunogen
GRK6 (AAH17272, 71 a.a. - 170 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CATRPELSRCVAFLDGVAEYEVTPDDKRKACGRQLTQNFLSHTGPDLIPEVPRQLVTNCTQRLEQGPCKDLFQELTRLTHEYLSVAPFADYLDSIYFNRF
Specificity
GRK6 - G protein-coupled receptor kinase 6
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GRK6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GRK6 Antibody (8B7)

  • EC 2.7.11
  • EC 2.7.11.16
  • FLJ32135
  • G protein-coupled receptor kinase 6
  • GPRK6G protein-coupled receptor kinase GRK6

Background

This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. Several transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4339
Species: Hu, Mu, Rt
Applications: WB, IHC
AF4539
Species: Hu, Mu, Rt
Applications: WB
NBP1-90008
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55415
Species: Hu
Applications: WB, ICC/IF
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NLS418
Species: Hu
Applications: IHC-P
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00441931-R02
Species: Hu
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00442206-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00002870-M07
Species: Hu
Applications: WB, ELISA

Publications for GRK6 Antibody (H00002870-M07) (0)

There are no publications for GRK6 Antibody (H00002870-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRK6 Antibody (H00002870-M07) (0)

There are no reviews for GRK6 Antibody (H00002870-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRK6 Antibody (H00002870-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRK6 Products

Bioinformatics Tool for GRK6 Antibody (H00002870-M07)

Discover related pathways, diseases and genes to GRK6 Antibody (H00002870-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRK6 Antibody (H00002870-M07)

Discover more about diseases related to GRK6 Antibody (H00002870-M07).
 

Pathways for GRK6 Antibody (H00002870-M07)

View related products by pathway.

PTMs for GRK6 Antibody (H00002870-M07)

Learn more about PTMs related to GRK6 Antibody (H00002870-M07).
 

Research Areas for GRK6 Antibody (H00002870-M07)

Find related products by research area.

Blogs on GRK6

There are no specific blogs for GRK6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRK6 Antibody (8B7) and receive a gift card or discount.

Bioinformatics

Gene Symbol GRK6
Entrez
OMIM
Uniprot