GRK4 Antibody (6D5)

Images

 
Sandwich ELISA: GRK4 Antibody (6D5) [H00002868-M02] - Detection limit for recombinant GST tagged GRK4 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6D5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GRK4 Antibody (6D5) Summary

Immunogen
GRK4 (NP_892027, 36 a.a. - 145 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LPPVSQCSELRHSIEKDYSSLCDKQPIGRRLFRQFCDTKPTLKRHIEFLDAVAEYEVADDEDRSDCGLSILDRFFNDKLAAPLPEIPPDVVTECRLGLKEENPSKKAFEE
Specificity
GRK4 - G protein-coupled receptor kinase 4
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GRK4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GRK4 Antibody (6D5)

  • EC 2.7.11
  • EC 2.7.11.16
  • G protein-coupled receptor kinase 2-like (Drosophila)
  • G protein-coupled receptor kinase 4
  • G protein-coupled receptor kinase GRK4
  • GPRK2LIT11
  • GPRK4GRK4a
  • G-protein coupled receptor kinase 4
  • ITI1

Background

This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating its deactivation. This gene has been linked to both genetic and acquired hypertension.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4339
Species: Hu, Mu, Rt
Applications: WB, IHC
AF4539
Species: Hu, Mu, Rt
Applications: WB
NBP1-90008
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83334
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB120-2776
Species: Hu, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NLS418
Species: Hu
Applications: IHC-P
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00442206-R02
Species: Hu

Publications for GRK4 Antibody (H00002868-M02) (0)

There are no publications for GRK4 Antibody (H00002868-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRK4 Antibody (H00002868-M02) (0)

There are no reviews for GRK4 Antibody (H00002868-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRK4 Antibody (H00002868-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRK4 Products

Bioinformatics Tool for GRK4 Antibody (H00002868-M02)

Discover related pathways, diseases and genes to GRK4 Antibody (H00002868-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRK4 Antibody (H00002868-M02)

Discover more about diseases related to GRK4 Antibody (H00002868-M02).
 

Pathways for GRK4 Antibody (H00002868-M02)

View related products by pathway.

PTMs for GRK4 Antibody (H00002868-M02)

Learn more about PTMs related to GRK4 Antibody (H00002868-M02).
 

Research Areas for GRK4 Antibody (H00002868-M02)

Find related products by research area.

Blogs on GRK4

There are no specific blogs for GRK4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRK4 Antibody (6D5) and receive a gift card or discount.

Bioinformatics

Gene Symbol GRK4
Entrez
OMIM
Uniprot