Recombinant Human GRAF Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human GRAF Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 249-336 of Human GRAF

Source: Wheat Germ

Amino Acid Sequence: LMKKMKENPLEHKTISPYTMEGYLYVQEKRHFGTSWVKHYCTYQRDSKQITMVPFDQKSGGKGGEDESVILKSCTRRKTDSIEKRFCF

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ARHGAP26
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
35.42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GRAF Protein

  • FLJ42530
  • GRAFGTPase regulator associated with focal adhesion kinase pp125(FAK)
  • KIAA0621rho GTPase-activating protein 26
  • Oligophrenin-1-like protein
  • OPHN1L1
  • OPHN1LGTPase regulator associated with focal adhesion kinase
  • Rho GTPase activating protein 26
  • Rho-type GTPase-activating protein 26

Background

ARHGAP26 - Rho GTPase activating protein 26

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS2656
Species: Hu
Applications: WB, IHC, IHC-P, ICC
NB400-153
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-56094
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-52406
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P
H00057522-M03
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-83870
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
NBP1-36945
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00023092-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for GRAF Partial Recombinant Protein (H00023092-Q01) (0)

There are no publications for GRAF Partial Recombinant Protein (H00023092-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRAF Partial Recombinant Protein (H00023092-Q01) (0)

There are no reviews for GRAF Partial Recombinant Protein (H00023092-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRAF Partial Recombinant Protein (H00023092-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for GRAF Partial Recombinant Protein (H00023092-Q01)

Discover related pathways, diseases and genes to GRAF Partial Recombinant Protein (H00023092-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRAF Partial Recombinant Protein (H00023092-Q01)

Discover more about diseases related to GRAF Partial Recombinant Protein (H00023092-Q01).
 

Pathways for GRAF Partial Recombinant Protein (H00023092-Q01)

View related products by pathway.

PTMs for GRAF Partial Recombinant Protein (H00023092-Q01)

Learn more about PTMs related to GRAF Partial Recombinant Protein (H00023092-Q01).
 

Research Areas for GRAF Partial Recombinant Protein (H00023092-Q01)

Find related products by research area.

Blogs on GRAF

There are no specific blogs for GRAF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GRAF Antibody
NBP1-89732

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GRAF Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP26