GPR82 Antibody - BSA Free

Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells, germinal center cells were moderately stained.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GPR82 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GPR82 Antibody - BSA Free (NBP1-86298) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AISRYATLMQKDSSQETTSCYEKIFYGHLLKKFRQPNFAR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR82
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GPR82 Protein (NBP1-86298PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GPR82 Antibody - BSA Free

• G protein-coupled receptor 82
• GPR82
• probable G-protein coupled receptor 82

Background

The G protein-coupled receptor GPR82 is a Orphan-A GPCR with an unknown ligand.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR82