GPR75 Antibody - BSA Free

Western Blot: GPR75 Antibody [NBP1-59406] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Western Blot: GPR75 Antibody [NBP1-59406] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Western Blot: GPR75 Antibody [NBP1-59406] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GPR75 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GPR75(G protein-coupled receptor 75) The peptide sequence was selected from the middle region of GPR75. Peptide sequence GQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHY. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR75
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GPR75 Antibody - BSA Free

• G protein-coupled receptor 75
• GPR75
• GPRchr2
• MGC132002
• probable G-protein coupled receptor 75
• WI31133
• WI-31133

Background

GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1894 AK314885.1 1-1894 1895-2115 AF072693.1 1834-2054

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GPR75 Antibody (NBP1-59406)(1)

Publication using NBP1-59406

• Speidell A, Walton S, Campbell LA et al. Mice deficient for G-protein-coupled receptor 75 display altered presynaptic structural protein expression and disrupted fear conditioning recall Journal of neurochemistry 2023-03-28 [PMID: 36978267] (WB)

Bioinformatics

• Gene Symbol: GPR75
• Uniprot:
  • B2RC02(Human)