GPR63 Antibody


Immunocytochemistry/ Immunofluorescence: GPR63 Antibody [NBP1-82362] - Staining of human cell line U-2 OS shows localization to nucleus, plasma membrane & cytosol.
Immunocytochemistry/ Immunofluorescence: GPR63 Antibody [NBP1-82362] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells and cells in granular layer.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

GPR63 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:NTTFVVYENTYMNITLPPPFQHPDLSPLLRYSFETMAPTGLSSLTVNSTAVPTTPAAFKSLNLPLQ
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GPR63 Protein (NBP1-82362PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GPR63 Antibody

  • brain expressed G-protein-coupled receptor PSP24 beta
  • G protein-coupled receptor 63
  • GPR63
  • probable G-protein coupled receptor 63
  • PSP24-2
  • PSP24B
  • PSP24-beta
  • PSP24BPSP24(beta)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ELISA, ICC/IF
Species: Hu, Mu, Rt, Bt, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC, IHC-P
Species: Hu
Applications: IHC-P
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: Flow, CyTOF-ready, ICC
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu
Applications: IHC, IHC-P

Publications for GPR63 Antibody (NBP1-82362) (0)

There are no publications for GPR63 Antibody (NBP1-82362).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR63 Antibody (NBP1-82362) (0)

There are no reviews for GPR63 Antibody (NBP1-82362). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GPR63 Antibody (NBP1-82362) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GPR63 Products

Bioinformatics Tool for GPR63 Antibody (NBP1-82362)

Discover related pathways, diseases and genes to GPR63 Antibody (NBP1-82362). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR63 Antibody (NBP1-82362)

Discover more about diseases related to GPR63 Antibody (NBP1-82362).

Pathways for GPR63 Antibody (NBP1-82362)

View related products by pathway.

Research Areas for GPR63 Antibody (NBP1-82362)

Find related products by research area.

Blogs on GPR63

There are no specific blogs for GPR63, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GPR63 Antibody and receive a gift card or discount.


Gene Symbol GPR63