GPR37 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPR37. Source: E. coli Amino Acid Sequence: RWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
GPR37 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55267. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for GPR37 Recombinant Protein Antigen
Background
GPR37 is an Orphan-A GPCR with an unknown ligand. GPR37 was recently identified as the PAEL receptor, a Parkin substrate involved in autosomal recessive juvenile Parkinson's (PDJ) disease. The PAEL receptor becomes unfolded, insoluble, and ubiquitinated when overexpressed, leading to unfolded protein-induced cell death. When the PAEL receptor is ubiquitinated by Parkin, it gets degraded, resulting in the suppression of cell death. The insoluble form of the PAEL receptor accumulates in the brains of PDJ patients and may cause selective neuronal death. GPR37 expression has been reported in brain, liver, and placenta. ESTs have been isolated from brain, embryo, eye, fetal lung/testis/Bcell, gallbladder, heart, liver, liver/spleen, melanocyte/uterus/fetal heart, nerve, placenta, testis, tonsil, and vessel libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: ELISA, IHC, , WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, IP, WB
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: AC
Publications for GPR37 Recombinant Protein Antigen (NBP2-55267PEP) (0)
There are no publications for GPR37 Recombinant Protein Antigen (NBP2-55267PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GPR37 Recombinant Protein Antigen (NBP2-55267PEP) (0)
There are no reviews for GPR37 Recombinant Protein Antigen (NBP2-55267PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for GPR37 Recombinant Protein Antigen (NBP2-55267PEP) (0)
Additional GPR37 Products
Research Areas for GPR37 Recombinant Protein Antigen (NBP2-55267PEP)
Find related products by research area.
|
Blogs on GPR37