GPR34 Antibody - Azide and BSA Free

Western Blot: GPR34 Antibody [H00002857-B01P] - Analysis of GPR34 expression in transfected 293T cell line by GPR34 polyclonal antibody. Lane 1: GPR34 transfected lysate(42.02 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: GPR34 Antibody [H00002857-B01P] - Analysis of purified antibody to GPR34 on 293 cell. (antibody concentration 1 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GPR34 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: GPR34 (AAH20678.1, 1 a.a. - 381 a.a.) full-length human protein. MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTSYSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKWTLGVILCKVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWMLALGGFLTMIILTLKKGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIKIGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCYWKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFKPGYSLHDTSVAVKIQSSSKST
• Specificity: Reacts with G protein-coupled receptor 34.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: GPR34
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: This antibody is useful for IF and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GPR34 Antibody - Azide and BSA Free

• G protein-coupled receptor 34
• GPR34
• probable G-protein coupled receptor 34

Background

G protein-coupled receptors (GPCRs), such as GPR34, are integral membrane proteins containing 7 putative transmembrane domains (TMs). These proteins mediate signals to the interior of the cell via activation of heterotrimeric G proteins that in turn activate various effector proteins, ultimately resulting in a physiologic response.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GPR34 Antibody (H00002857-B01P)(1)

Publication using H00002857-B01P

• Bo Z, Na W, Shen Y et al. G-protein coupled receptor 34 regulates the proliferation and growth of LS174T cells through differential expression of PI3K subunits and PTEN. Mol Biol Rep. 2022-01-08 [PMID: 34997428]

Bioinformatics

• Gene Symbol: GPR34
• Entrez:
  • 2857(Human)
• Uniprot:
  • AAH20678.1(Human)