GPR34 Antibody

Images

 
Western Blot: GPR34 Antibody [H00002857-B01P] - Analysis of GPR34 expression in transfected 293T cell line by GPR34 polyclonal antibody. Lane 1: GPR34 transfected lysate(42.02 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: GPR34 Antibody [H00002857-B01P] - Analysis of purified antibody to GPR34 on 293 cell. (antibody concentration 1 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GPR34 Antibody Summary

Immunogen
GPR34 (AAH20678.1, 1 a.a. - 381 a.a.) full-length human protein. MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTSYSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKWTLGVILCKVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWMLALGGFLTMIILTLKKGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIKIGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCYWKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFKPGYSLHDTSVAVKIQSSSKST
Specificity
Reacts with G protein-coupled receptor 34.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
GPR34
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
This antibody is useful for IF and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GPR34 Antibody

  • G protein-coupled receptor 34
  • GPR34
  • probable G-protein coupled receptor 34

Background

G protein-coupled receptors (GPCRs), such as GPR34, are integral membrane proteins containing 7 putative transmembrane domains (TMs). These proteins mediate signals to the interior of the cell via activation of heterotrimeric G proteins that in turn activate various effector proteins, ultimately resulting in a physiologic response.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NLS418
Species: Hu
Applications: IHC-P
H00442206-R02
Species: Hu
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-83345
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82438
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
NB100-58974
Species: Hu, Bv, Mk, Pm, Rb
Applications: IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP2-14197
Species: Hu
Applications: IHC, IHC-P

Publications for GPR34 Antibody (H00002857-B01P) (0)

There are no publications for GPR34 Antibody (H00002857-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR34 Antibody (H00002857-B01P) (0)

There are no reviews for GPR34 Antibody (H00002857-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GPR34 Antibody (H00002857-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR34 Products

Bioinformatics Tool for GPR34 Antibody (H00002857-B01P)

Discover related pathways, diseases and genes to GPR34 Antibody (H00002857-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR34 Antibody (H00002857-B01P)

Discover more about diseases related to GPR34 Antibody (H00002857-B01P).
 

Pathways for GPR34 Antibody (H00002857-B01P)

View related products by pathway.

PTMs for GPR34 Antibody (H00002857-B01P)

Learn more about PTMs related to GPR34 Antibody (H00002857-B01P).
 

Research Areas for GPR34 Antibody (H00002857-B01P)

Find related products by research area.

Blogs on GPR34

There are no specific blogs for GPR34, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR34 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR34
Entrez
Uniprot