GPR19 Antibody

Images

 
Western Blot: GPR19 Antibody [NBP2-87523] - WB Suggested Anti-GPR19 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal kidney
Western Blot: GPR19 Antibody [NBP2-87523] - Host: Rabbit. Target: GPR19. Positive control (+): MCF7 (N10). Negative control (-): 293T (2T). Antibody concentration: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPR19 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of GPR19. Peptide sequence: LNLLFLLSWLPFHVAQLWHPHEQDYKKSSLVFTAITWISFSSSASKPTLY The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
GPR19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPR19 Antibody

  • G protein-coupled receptor 19
  • GPR19
  • GPR-NGA
  • probable G-protein coupled receptor 19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS418
Species: Hu
Applications: IHC, IHC-P
NLS2756
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
AF194
Species: Mu
Applications: IHC, WB
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NLS1017
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
NLS2576
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
DGP00
Species: Hu
Applications: ELISA
NBP2-67899
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-92952
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KO, WB
NB100-77903
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr
AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NB100-1598
Species: Hu, Mu
Applications: Flow, ICC/IF, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-89489
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-87523
Species: Hu
Applications: WB

Publications for GPR19 Antibody (NBP2-87523) (0)

There are no publications for GPR19 Antibody (NBP2-87523).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR19 Antibody (NBP2-87523) (0)

There are no reviews for GPR19 Antibody (NBP2-87523). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPR19 Antibody (NBP2-87523) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR19 Products

Array NBP2-87523

Bioinformatics Tool for GPR19 Antibody (NBP2-87523)

Discover related pathways, diseases and genes to GPR19 Antibody (NBP2-87523). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR19 Antibody (NBP2-87523)

Discover more about diseases related to GPR19 Antibody (NBP2-87523).
 

Pathways for GPR19 Antibody (NBP2-87523)

View related products by pathway.

PTMs for GPR19 Antibody (NBP2-87523)

Learn more about PTMs related to GPR19 Antibody (NBP2-87523).
 

Research Areas for GPR19 Antibody (NBP2-87523)

Find related products by research area.

Blogs on GPR19

There are no specific blogs for GPR19, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR19