GPR19 Antibody - BSA Free

Western Blot: GPR19 Antibody [NBP2-87523] - WB Suggested Anti-GPR19 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal kidney

Western Blot: GPR19 Antibody [NBP2-87523] - Host: Rabbit. Target: GPR19. Positive control (+): MCF7 (N10). Negative control (-): 293T (2T). Antibody concentration: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GPR19 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GPR19 Antibody - BSA Free (NBP2-87523) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of GPR19. Peptide sequence: LNLLFLLSWLPFHVAQLWHPHEQDYKKSSLVFTAITWISFSSSASKPTLY The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR19
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GPR19 Antibody - BSA Free

• G protein-coupled receptor 19
• GPR19
• GPR-NGA
• probable G-protein coupled receptor 19

Background

GPR19 is an Orphan-A GPCR with an unknown ligand. GPR19 has been reported in human in regions overlapping with the dopamine D2 receptor expression in the brain and peripheral nervous system. ESTs have been isolated from human brain, nerve, and germ-cell tumor libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR19