GPR18 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GPR18. Peptide sequence: GVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDIIYLKAVNVLNLTRLT The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GPR18 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for GPR18 Antibody - BSA Free
Background
GPR18 is an Orphan-A GPCR with no known ligand. GPR18 has been reported to be expressed at high levels in testis and spleen and at lower levels in other tissues associated with endocrine and immunologic/hematologic functions. ESTs have been isolated from human blood, bone marrow, brain, colon, liver/spleen, lymph, lymph node, testis, and tonsil libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Species: Hu, Pm, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
Species: Bt, Bv, Ca, Eq, Hu, Pm, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Pm, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Ca, Hu
Applications: IHC, IHC-Fr, IHC-P, WB
Publications for GPR18 Antibody (NBP2-87522) (0)
There are no publications for GPR18 Antibody (NBP2-87522).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GPR18 Antibody (NBP2-87522) (0)
There are no reviews for GPR18 Antibody (NBP2-87522).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GPR18 Antibody (NBP2-87522) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GPR18 Products
Research Areas for GPR18 Antibody (NBP2-87522)
Find related products by research area.
|
Blogs on GPR18