GPR18 Antibody - BSA Free

Western Blot: GPR18 Antibody [NBP2-87522] - WB Suggested Anti-GPR18 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Muscle

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GPR18 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GPR18 Antibody - BSA Free (NBP2-87522) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GPR18. Peptide sequence: GVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDIIYLKAVNVLNLTRLT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR18
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GPR18 Antibody - BSA Free

• G protein-coupled receptor 18
• GPCRW
• GPR18
• G-protein coupled receptor 18
• NAGly Receptor
• N-arachidonyl glycine receptor

Background

GPR18 is an Orphan-A GPCR with no known ligand. GPR18 has been reported to be expressed at high levels in testis and spleen and at lower levels in other tissues associated with endocrine and immunologic/hematologic functions. ESTs have been isolated from human blood, bone marrow, brain, colon, liver/spleen, lymph, lymph node, testis, and tonsil libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR18