GPR160 Antibody

Images

 
Western Blot: GPR160 Antibody [NBP3-09485] - Western blot analysis of GPR160 in Hela Whole cell as a positive control. Antibody dilution at 1.0 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPR160 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR160 (NP_055188). Peptide sequence FSSHSSYTVRSKKIFLSKLIVCFLSTWLPFVLLQVIIVLLKVQIPAYIEM
Clonality
Polyclonal
Host
Rabbit
Gene
GPR160
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for GPR160 Antibody

  • G protein-coupled receptor 160
  • GPCR150GPCR1
  • GPR160
  • G-protein coupled receptor GPCR1
  • hGPCR1
  • probable G-protein coupled receptor 160
  • putative G protein-coupled receptor

Background

GPCR150 is an Orphan-A GPCR with an unknown ligand. ESTs for GPCR150 have been isolated from a diverse set of human tissue libraries, including normal small intestine, kidney, skeletal muscle and tonsil, and cancerous blood, bladder, placenta and parathyroid.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NLS418
Species: Hu
Applications: IHC, IHC-P
NLS2756
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
NLS1017
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
NLS2576
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
NBP2-24488
Species: Hu, Pm
Applications: IHC, IHC-P, WB
MAB42273
Species: Hu
Applications: CyTOF-ready, Flow, IHC
H00005457-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-57048
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
MAB172
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
AF5825
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

Publications for GPR160 Antibody (NBP3-09485) (0)

There are no publications for GPR160 Antibody (NBP3-09485).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR160 Antibody (NBP3-09485) (0)

There are no reviews for GPR160 Antibody (NBP3-09485). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPR160 Antibody (NBP3-09485) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR160 Products

Bioinformatics Tool for GPR160 Antibody (NBP3-09485)

Discover related pathways, diseases and genes to GPR160 Antibody (NBP3-09485). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR160 Antibody (NBP3-09485)

Discover more about diseases related to GPR160 Antibody (NBP3-09485).
 

Pathways for GPR160 Antibody (NBP3-09485)

View related products by pathway.

PTMs for GPR160 Antibody (NBP3-09485)

Learn more about PTMs related to GPR160 Antibody (NBP3-09485).
 

Research Areas for GPR160 Antibody (NBP3-09485)

Find related products by research area.

Blogs on GPR160

There are no specific blogs for GPR160, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR160 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR160