GPR142 Antibody


Western Blot: GPR142 Antibody [NBP1-87286] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17,11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4:Human Plasma. Lane 5: Human liver tissue. more
Immunocytochemistry/ Immunofluorescence: GPR142 Antibody [NBP1-87286] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: GPR142 Antibody [NBP1-87286] - Staining of human colon shows strong membranous and cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

GPR142 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: AVLGTEAYTEEDKSMVSHAQKSQHSCLSHSRWLRSPQVTGGSWDLRIRPSKDSSSFRQAQ
Specificity of human GPR142 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GPR142 Protein (NBP1-87286PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GPR142 Antibody

  • G protein-coupled receptor 142
  • GPR142
  • PGR2
  • PGR2G-protein coupled receptor PGR2
  • probable G-protein coupled receptor 142


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Ch, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
Species: Hu
Applications: IHC-P
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: IHC-P
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
Species: Hu, Mk
Applications: IHC-P, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Ch, Re
Applications: WB
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GPR142 Antibody (NBP1-87286) (0)

There are no publications for GPR142 Antibody (NBP1-87286).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR142 Antibody (NBP1-87286) (0)

There are no reviews for GPR142 Antibody (NBP1-87286). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GPR142 Antibody (NBP1-87286) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GPR142 Products

Bioinformatics Tool for GPR142 Antibody (NBP1-87286)

Discover related pathways, diseases and genes to GPR142 Antibody (NBP1-87286). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR142 Antibody (NBP1-87286)

Discover more about diseases related to GPR142 Antibody (NBP1-87286).

Pathways for GPR142 Antibody (NBP1-87286)

View related products by pathway.

Blogs on GPR142

There are no specific blogs for GPR142, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GPR142 Antibody and receive a gift card or discount.


Gene Symbol GPR142