GPR142 Antibody

Images

 
Western Blot: GPR142 Antibody [NBP1-87286] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17,11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4:Human Plasma. Lane 5: Human liver tissue. ...read more
Immunocytochemistry/ Immunofluorescence: GPR142 Antibody [NBP1-87286] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: GPR142 Antibody [NBP1-87286] - Staining of human colon shows strong membranous and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPR142 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AVLGTEAYTEEDKSMVSHAQKSQHSCLSHSRWLRSPQVTGGSWDLRIRPSKDSSSFRQAQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPR142
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GPR142 Protein (NBP1-87286PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPR142 Antibody

  • G protein-coupled receptor 142
  • GPR142
  • PGR2
  • PGR2G-protein coupled receptor PGR2
  • probable G-protein coupled receptor 142

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS2717
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Ch, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
NLS418
Species: Hu
Applications: IHC-P
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00442206-R02
Species: Hu
H00441931-R02
Species: Hu
NBP1-00858
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB110-92756
Species: Hu, Mu, Ch, Re
Applications: WB
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13701
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-87286
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GPR142 Antibody (NBP1-87286) (0)

There are no publications for GPR142 Antibody (NBP1-87286).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR142 Antibody (NBP1-87286) (0)

There are no reviews for GPR142 Antibody (NBP1-87286). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GPR142 Antibody (NBP1-87286) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR142 Products

Bioinformatics Tool for GPR142 Antibody (NBP1-87286)

Discover related pathways, diseases and genes to GPR142 Antibody (NBP1-87286). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR142 Antibody (NBP1-87286)

Discover more about diseases related to GPR142 Antibody (NBP1-87286).
 

Pathways for GPR142 Antibody (NBP1-87286)

View related products by pathway.

Blogs on GPR142

There are no specific blogs for GPR142, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR142 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR142
Entrez