GPR12 Antibody

Immunohistochemistry: GPR12 Antibody [NBP2-48989] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Discontinued

GPR12 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR12
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GPR12 Antibody

• FLJ18149
• FLJ97704
• G protein-coupled receptor 12
• GPCR12
• GPCR21
• GPR12
• G-protein coupled receptor 12
• MGC138349
• MGC138351

Background

GPCR GPR12 is a G protein coupled receptor. A variety of extracellular signals are transmitted into cells through integral membrane receptors coupled to heterotrimeric G proteins. Such G protein coupled receptors are critical for the normal functions of many cell types: neurons, endocrine cells, cardiac and smooth muscle cells, and sensory cells for detection of light, taste, and smell. Both activating and loss of function mutations in G protein coupled receptors have been found as the cause of human diseases. The GPR12 gene is located on human chromosome 13q12. GPR12 expression has been reported primarily in the central nervous system. Rat transcripts have been identified at low levels in testis and pituitary gland. ESTs have been isolated from human brain and eye libraries, as well as mouse brain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR12