GPR107 Antibody - BSA Free

Immunohistochemistry-Paraffin: GPR107 Antibody [NBP1-83629] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: GPR107 Antibody [NBP1-83629] - Analysis in human prostate and liver tissues. Corresponding GPR107 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: GPR107 Antibody [NBP1-83629] - Staining of human cerebral cortex shows strong positivity in Golgi apparatus in neurons.

Immunohistochemistry-Paraffin: GPR107 Antibody [NBP1-83629] - Staining of human Fallopian tube shows strong positivity in Golgi apparatus in glandular cells.

Staining of human prostate shows strong positivity in Golgi apparatus in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GPR107 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KFRPASDNPYLQLSQEEEDLEMESVVTTSGVMESMKKVKKVTNGSVEPQGEWEGSV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR107
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GPR107 Protein (NBP1-83629PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GPR107 Antibody - BSA Free

• BA138E2.2
• DKFZp667C222
• FLJ16312
• FLJ20998
• FLJ22591
• G protein-coupled receptor 107
• GPR107
• KIAA1624
• KIAA1624GCDRP
• Lung seven transmembrane receptor 1
• LUSTR1
• LUSTR1MGC126118
• MGC15440
• protein GPR107
• RP11-88G17

Background

The GPR107 gene encodes protein GPR107 that in isoform 1 is 600 amino acids long, 66 kDA, in isoform 2 is 552 amino acids long, 61 KDA, and in isoform 3 is 300 amino acids long, 33 kDA. GPR107 is known to interact with the gene UBC. It has been researched regarding its role in nail-patella syndrome, basal cell carcinoma, spina bifida, and focal dermal hypoplasia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR107