GNG13 Antibody - BSA Free

Western Blot: GNG13 Antibody [NBP1-98572] - Rat lung

Immunohistochemistry-Frozen: GNG13 Antibody [NBP1-98572] - Mouse retina cryosection stained with GNG13 antibody (5 ug/ml).

• Reactivity: Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GNG13 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is Gng13 - N-terminal region. Peptide sequence PQMKKEVESLKYQLAFKREMSSKTIPELLKWIEDGIPKDPFLNPDLMKNN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GNG13
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Western Blot 1.0 ug/ml
• Application Notes: Use in Immunohistochemistry reported in scientific literature (PMID: 30027108).
• Theoretical MW: 7 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GNG13 Antibody - BSA Free

• G gamma subunit, clone:h2-35
• G(gamma)13
• guanine nucleotide binding protein (G protein), gamma 13
• guanine nucleotide binding protein 13, gamma
• guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
• h2-35

Background

Heterotrimeric G proteins, which consist of alpha (see MIM 139320), beta (see MIM 139380), and gamma subunits, function as signal transducers for the 7-transmembrane-helix G protein-coupled receptors. GNG13 is a gamma subunit that is expressed in taste, retinal, and neuronal tissues and plays a key role in taste transduction (Li et al., 2006 (PubMed 16473877)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GNG13 Antibody (NBP1-98572)(1)

Publication using NBP1-98572

• Agosto M, Anastassov I, Robichaux M, Wensel T. A Large Endoplasmic Reticulum-Resident Pool of TRPM1 in Retinal ON-Bipolar Cells. eNeuro. [PMID: 30027108] (IF/IHC, Mouse)

Review for GNG13 Antibody (NBP1-98572) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Verified Customer IHC-Fr Mouse 08/02/2018

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: mouse retina
• Species: Mouse
• Lot: qc27569-40908

Bioinformatics

• Gene Symbol: GNG13
• Uniprot:
  • NP_001129390(Rat)