GNG13 Antibody

Images

 
Western Blot: GNG13 Antibody [NBP1-98572] - Rat lung
Immunohistochemistry-Frozen: GNG13 Antibody [NBP1-98572] - Mouse retina cryosection stained with GNG13 antibody (5 ug/ml).

Product Details

Summary
Reactivity Mu, Rt, GpSpecies Glossary
Applications WB, IHC, IHC-Fr
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GNG13 Antibody Summary

Immunogen
The immunogen for this antibody is Gng13 - N-terminal region. Peptide sequence PQMKKEVESLKYQLAFKREMSSKTIPELLKWIEDGIPKDPFLNPDLMKNN. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Guinea Pig (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNG13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
Application Notes
Use in Immunohistochemistry reported in scientific literature (PMID: 30027108).
Theoretical MW
7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
using
NBP1-98572 in the following applications:

Publications
Read Publication using
NBP1-98572 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GNG13 Antibody

  • G gamma subunit, clone:h2-35
  • G(gamma)13
  • guanine nucleotide binding protein (G protein), gamma 13
  • guanine nucleotide binding protein 13, gamma
  • guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
  • h2-35

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha, Pm
Applications: WB, Simple Western, IHC-Fr, KO
NBP2-13957
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-42632
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-98572
Species: Mu, Rt, Gp
Applications: WB, IHC, IHC-Fr

Publications for GNG13 Antibody (NBP1-98572)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Review for GNG13 Antibody (NBP1-98572) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-98572:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen GNG13 NBP1-98572
Enlarge
4
reviewed by:
Anonymous
IHC-Fr Mouse 08/02/2018
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample Testedmouse retina
SpeciesMouse
Lotqc27569-40908

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GNG13 Antibody (NBP1-98572) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GNG13 Products

Bioinformatics Tool for GNG13 Antibody (NBP1-98572)

Discover related pathways, diseases and genes to GNG13 Antibody (NBP1-98572). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GNG13

There are no specific blogs for GNG13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
08/02/2018
Application: IHC-Fr
Species: Mouse

Bioinformatics

Gene Symbol GNG13
Uniprot