GNG13 Antibody - BSA Free

Immunohistochemistry-Paraffin: GNG13 Antibody [NBP1-91950] - Staining of human eye, retina shows moderate membranous positivity in neuronal cells.

Immunohistochemistry-Paraffin: GNG13 Antibody [NBP1-91950] - Staining of human cerebellum shows strong positivity in neuronal processes in neuropil.

Immunohistochemistry-Paraffin: GNG13 Antibody [NBP1-91950] - Staining of human duodenum shows strong positivity in enteroendocrine cells.

Immunohistochemistry-Paraffin: GNG13 Antibody [NBP1-91950] - Staining of human prostate shows no positivity in glandular cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GNG13 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GNG13
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GNG13 Protein (NBP1-91950PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GNG13 Antibody - BSA Free

• G gamma subunit, clone:h2-35
• G(gamma)13
• guanine nucleotide binding protein (G protein), gamma 13
• guanine nucleotide binding protein 13, gamma
• guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
• h2-35

Background

Heterotrimeric G proteins, which consist of alpha (see MIM 139320), beta (see MIM 139380), and gamma subunits, function as signal transducers for the 7-transmembrane-helix G protein-coupled receptors. GNG13 is a gamma subunit that is expressed in taste, retinal, and neuronal tissues and plays a key role in taste transduction (Li et al., 2006 (PubMed 16473877)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GNG13