Recombinant Human GNA14 Protein

Images

 
There are currently no images for GNA14 Partial Recombinant Protein (H00009630-Q01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GNA14 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 150-250 of Human GNA14 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKAL

Protein/Peptide Type
Partial Recombinant Protein
Gene
GNA14

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GNA14 Protein

  • G alpha-14
  • G-protein subunit alpha-14
  • guanine nucleotide binding protein (G protein), alpha 14
  • guanine nucleotide-binding protein 14
  • guanine nucleotide-binding protein subunit alpha-14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-85641
Species: Hu
Applications: IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB300-157
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
AF2988
Species: Mu, Rt
Applications: WB
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
H00008601-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-32521
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NBP2-37582
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-48700
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NBP2-20571
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009630-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for GNA14 Partial Recombinant Protein (H00009630-Q01) (0)

There are no publications for GNA14 Partial Recombinant Protein (H00009630-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNA14 Partial Recombinant Protein (H00009630-Q01) (0)

There are no reviews for GNA14 Partial Recombinant Protein (H00009630-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GNA14 Partial Recombinant Protein (H00009630-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GNA14 Products

Bioinformatics Tool for GNA14 Partial Recombinant Protein (H00009630-Q01)

Discover related pathways, diseases and genes to GNA14 Partial Recombinant Protein (H00009630-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GNA14 Partial Recombinant Protein (H00009630-Q01)

Discover more about diseases related to GNA14 Partial Recombinant Protein (H00009630-Q01).
 

Pathways for GNA14 Partial Recombinant Protein (H00009630-Q01)

View related products by pathway.

PTMs for GNA14 Partial Recombinant Protein (H00009630-Q01)

Learn more about PTMs related to GNA14 Partial Recombinant Protein (H00009630-Q01).
 

Research Areas for GNA14 Partial Recombinant Protein (H00009630-Q01)

Find related products by research area.

Blogs on GNA14

There are no specific blogs for GNA14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GNA14 Antibody (2H8)
H00009630-M06-100ug

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GNA14 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GNA14